Glyma18g04650 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g04650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g04650): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g04650

Feature Type:	gene_model
Chromosome:	Gm18
Start:	3434642
stop:	3436257
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g04650

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G37600	AT	Annotation by Michelle Graham. TAIR10: glutamine synthase clone R1 \| chr5:14933574-14935656 REVERSE LENGTH=356	SoyBase	E_val: 2.00E-29	ISS
GO:0009744	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus	SoyBase	N/A	ISS
GO:0009749	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus	SoyBase	N/A	ISS
GO:0009750	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus	SoyBase	N/A	ISS
GO:0010150	GO-bp	Annotation by Michelle Graham. GO Biological Process: leaf senescence	SoyBase	N/A	ISS
GO:0042128	GO-bp	Annotation by Michelle Graham. GO Biological Process: nitrate assimilation	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0004356	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glutamate-ammonia ligase activity	SoyBase	N/A	ISS
GO:0005507	GO-mf	Annotation by Michelle Graham. GO Molecular Function: copper ion binding	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PTHR20852	Panther	GLUTAMINE SYNTHETASE	JGI		ISS
PTHR20852:SF14	Panther	GLUTAMINE SYNTHETASE (GLUTAMATE--AMMONIA LIGASE) (	JGI		ISS
PF03951	PFAM	Glutamine synthetase, beta-Grasp domain	JGI		ISS
UniRef100_C6TJN5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Glutamine synthetase n=1 Tax=Glycine max RepID=C6TJN5_SOYBN	SoyBase	E_val: 2.00E-28	ISS
UniRef100_C6TJN5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Glutamine synthetase n=1 Tax=Glycine max RepID=C6TJN5_SOYBN	SoyBase	E_val: 2.00E-28	ISS

Expression Patterns of Glyma18g04650

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g04650 not represented in the dataset	Glyma18g04650 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g04650 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma18g04650

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g04650

Limit To All Plant Sequences

>Glyma18g04650.1   sequence type=CDS   gene model=Glyma18g04650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGAAGAACTAATGCTTGGTGGTGGCCAGAAGAAAAGATAATTTTAACAATCATTATACCGAAGAAAAAAAATACTCTCCCAGGACCAGTTAGCGACCCTTCAAAGCTTCCCAAGTGGAACTATGATGGTTCCAGCACAGGCCAAGCTCCTGGAGAAGACAGTGAAGTGATTATATACCCACAAGCCATTTTCAGGGATCCATTCAGAAGGGGCAACAATATCTTGATTACCGCGACAACCATTCCAGAAAATACTCAAGACATGATTCTTAAAGTAATTATTACAAAGATCAACAATTATATCATTTCATTAATTGGGGTAACAATGGAAAAAATCTTTACTGACAAAATCAAGTTGGGTTTTATTTTT

Predicted protein sequences of Glyma18g04650

Limit To All Plant Sequences

>Glyma18g04650.1   sequence type=predicted peptide   gene model=Glyma18g04650   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RRTNAWWWPEEKIILTIIIPKKKNTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVIIYPQAIFRDPFRRGNNILITATTIPENTQDMILKVIITKINNYIISLIGVTMEKIFTDKIKLGFIF

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain