|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G37600 | AT | Annotation by Michelle Graham. TAIR10: glutamine synthase clone R1 | chr5:14933574-14935656 REVERSE LENGTH=356 | SoyBase | E_val: 2.00E-29 | ISS |
| GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS |
| GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS |
| GO:0010150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf senescence | SoyBase | N/A | ISS |
| GO:0042128 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate assimilation | SoyBase | N/A | ISS |
| GO:0005618 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell wall | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0022626 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome | SoyBase | N/A | ISS |
| GO:0003824 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: catalytic activity | SoyBase | N/A | ISS |
| GO:0004356 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: glutamate-ammonia ligase activity | SoyBase | N/A | ISS |
| GO:0005507 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: copper ion binding | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR20852 | Panther | GLUTAMINE SYNTHETASE | JGI | ISS | |
| PTHR20852:SF14 | Panther | GLUTAMINE SYNTHETASE (GLUTAMATE--AMMONIA LIGASE) ( | JGI | ISS | |
| PF03951 | PFAM | Glutamine synthetase, beta-Grasp domain | JGI | ISS | |
| UniRef100_C6TJN5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Glutamine synthetase n=1 Tax=Glycine max RepID=C6TJN5_SOYBN | SoyBase | E_val: 2.00E-28 | ISS |
| UniRef100_C6TJN5 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Glutamine synthetase n=1 Tax=Glycine max RepID=C6TJN5_SOYBN | SoyBase | E_val: 2.00E-28 | ISS |
|
Glyma18g04650 not represented in the dataset |
Glyma18g04650 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g04650.1 sequence type=CDS gene model=Glyma18g04650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high AGAAGAACTAATGCTTGGTGGTGGCCAGAAGAAAAGATAATTTTAACAATCATTATACCGAAGAAAAAAAATACTCTCCCAGGACCAGTTAGCGACCCTTCAAAGCTTCCCAAGTGGAACTATGATGGTTCCAGCACAGGCCAAGCTCCTGGAGAAGACAGTGAAGTGATTATATACCCACAAGCCATTTTCAGGGATCCATTCAGAAGGGGCAACAATATCTTGATTACCGCGACAACCATTCCAGAAAATACTCAAGACATGATTCTTAAAGTAATTATTACAAAGATCAACAATTATATCATTTCATTAATTGGGGTAACAATGGAAAAAATCTTTACTGACAAAATCAAGTTGGGTTTTATTTTT
>Glyma18g04650.1 sequence type=predicted peptide gene model=Glyma18g04650 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high RRTNAWWWPEEKIILTIIIPKKKNTLPGPVSDPSKLPKWNYDGSSTGQAPGEDSEVIIYPQAIFRDPFRRGNNILITATTIPENTQDMILKVIITKINNYIISLIGVTMEKIFTDKIKLGFIF
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||