Glyma18g04330 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g04330

Feature Type:	gene_model
Chromosome:	Gm18
Start:	3083899
stop:	3086063
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g04330

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G55470	AT	Annotation by Michelle Graham. TAIR10: Calcium-dependent lipid-binding (CaLB domain) family protein \| chr3:20564356-20566092 FORWARD LENGTH=155	SoyBase	E_val: 3.00E-48	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009963	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
KOG1030	KOG	Predicted Ca2+-dependent phospholipid-binding protein	JGI		ISS
PTHR10774	Panther	CALCIUM-DEPENDENT LIPID-BINDING PROTEIN (CALB RELATED)	JGI		ISS
PF00168	PFAM	C2 domain	JGI		ISS
UniRef100_C6TG79	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TG79_SOYBN	SoyBase	E_val: 4.00E-106	ISS
UniRef100_D0R6I8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: C2 domain-containing protein n=1 Tax=Malus x domestica RepID=D0R6I8_MALDO	SoyBase	E_val: 2.00E-61	ISS

Expression Patterns of Glyma18g04330

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g04330

Paralog	Evidence	Comments
Glyma11g34000	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g04330 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g038400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g04330

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g04330

Limit To All Plant Sequences

>Glyma18g04330.1   sequence type=CDS   gene model=Glyma18g04330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAATTGGGTTTATGGAGGTGCAGCTTGTGAAAGCAAAGGGGTTGTGTGACACTGATTTCTTTGGTAGTATGGACCCGTATGTTGTGATACAGTACAACGGTCAAGAGCGAAGGAGTAGTGTTGCTAAGGGACAGGGCAATAATCCGGTGTGGAATGAGAAATTTGAGTTTAAGGTAGAATATCCTACACCAAGTAACTCATACAAGGTCATCTTAAAAATCATGGACAAGGATTCGTTATCTGCAGATGACTTTGTTGGTCAAGCCATAGTCTATGTGGAAGACTTATTAGCCATAGGGGTAGGGGATGGTGCAGCTGAGCTGCAACCTCTCAAGTACAGAGTAATTCGTGAAGATCAATCTTATTGTGGAGAAATTGATGTTGGTATAACTTTTAAGGTTGAAGAAGAGTTCAATGGAGAAACTAAACGAGGAAGGAAGGACAGCAACTAG

Predicted protein sequences of Glyma18g04330

Limit To All Plant Sequences

>Glyma18g04330.1   sequence type=predicted peptide   gene model=Glyma18g04330   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIGFMEVQLVKAKGLCDTDFFGSMDPYVVIQYNGQERRSSVAKGQGNNPVWNEKFEFKVEYPTPSNSYKVILKIMDKDSLSADDFVGQAIVYVEDLLAIGVGDGAAELQPLKYRVIREDQSYCGEIDVGITFKVEEEFNGETKRGRKDSN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain