SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g04240

Feature Type:gene_model
Chromosome:Gm18
Start:3004513
stop:3009993
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g04240
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13840AT Annotation by Michelle Graham. TAIR10: FIZZY-related 3 | chr5:4468677-4470706 REVERSE LENGTH=481 SoyBaseE_val: 0ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006306GO-bp Annotation by Michelle Graham. GO Biological Process: DNA methylation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0007276GO-bp Annotation by Michelle Graham. GO Biological Process: gamete generation SoyBaseN/AISS
GO:0008283GO-bp Annotation by Michelle Graham. GO Biological Process: cell proliferation SoyBaseN/AISS
GO:0031047GO-bp Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA SoyBaseN/AISS
GO:0032875GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of DNA endoreduplication SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0042127GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051225GO-bp Annotation by Michelle Graham. GO Biological Process: spindle assembly SoyBaseN/AISS
GO:0051302GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell division SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051510GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of unidimensional cell growth SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005834GO-cc Annotation by Michelle Graham. GO Cellular Compartment: heterotrimeric G-protein complex SoyBaseN/AISS
GO:0004871GO-mf Annotation by Michelle Graham. GO Molecular Function: signal transducer activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0305 KOG Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits JGI ISS
PTHR19918Panther CELL DIVISION CYCLE 20 (CDC20) (FIZZY)-RELATED JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_Q6T2Z5UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD-repeat cell cycle regulatory protein n=1 Tax=Glycine max RepID=Q6T2Z5_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI000233E59FUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E59F related cluster n=1 Tax=unknown RepID=UPI000233E59F SoyBaseE_val: 0ISS

Expression Patterns of Glyma18g04240
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g04240
ParalogEvidenceComments
Glyma11g34060 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g04240 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g037800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g04240
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g04240
>Glyma18g04240.1   sequence type=CDS   gene model=Glyma18g04240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGCGAAGAAATCGGGTTTGAATCTCCCAGCTGGGATGTCCGGAACCTCACTCCGGCTGGACACTGCAGCAGCATCTTCCATCTCGACCCTCAATTCTCCTTCTTCTCTCCGTTCCATCTCTAATCTCACCTCGCCTTCGAAATCCAACTCGGCTTGCAGCGACAGGTTCATTCCGTGCCGGTCCTCCTCGAGGTTGCACACGTTCGGGCTCCTGGACAGGCCCTCGCCGGTGAAGGAAGGGAGTAACGAGGCTTATTCCAGGTTGTTGAAATCAGAACTCTTTGGATCTGACTTTGCTTCTCCTTCTCTTTCTCTTTCTTCCCCTGCAGGTGCTGCTCCTCCTTCGCCGCTCAGCCCCAGCAAGAACATGCTCCGCTTCAAGACCGACCACTCCGTCGCGCCTTCTTCGCCTTATTCGCCGTCCATTTTGGGACAGCAGAATGCCTTTCCTTCTGACTCTTCTACCCCGCCTCCCAAACCTCCCAGGAAAGTCCTCAAGACGCCCCACAAGGTTTTGGATGCCCCATCACTTCAAGATGACTTTTATTTGAATCTGGTGGACTGGTCCACACAAAATGTTCTTGCTGTGGGGCTAGGCACTTGTGTGTATTTATGGAGCGCTTCAAACAGCAAAGTGACTAAGTTATGTGACTTGGGGCCTTATGATGGTGTCTGCTCTGTCCAGTGGACCCGGGAGGGTTCTTTTATATCCATTGGTACAAATCTTGGTCAAGTTCAGGTTTGGGATGGAACTCAGTGTAAGAAGGTCAGAACCATGGGTGGGCATCAGACAAGGACTGGTGTTTTGGCATGGAATTCTCGCATTTTGGCTTCAGGGAGCAGAGATAGGAACATACTTCAGCATGACATGAGGATTCCGGGTGACTTTGTTAGCAAGCTTGTTGGCCACAAGTCTGAGGTATGTGGATTGAAATGGTCCAGTGATGACAGGGAACTTGCTTCTGGTGGTAATGATAATCAGCTCCTGGTATGGAATCAACACTCTCAGCAACCAGTTTTGAGACTTACCGAGCACACTGCTGCTGTGAAGGCCATTGCTTGGTCACCTCACCAAAGCAGTCTCCTTGTGTCCGGAGGTGGAACTGCTGATAGGTGTATTCGTTTTTGGAACACTACAAATGGCCATCAATTGAACTGTCTTGACACTGGGAGCCAGGTCTGCAACCTTGCTTGGAGTAAAAATGTGAATGAACTAGTAAGCACTCATGGGTACTCCCAAAATCAGATCATGGTGTGGAAATATCCATCATTGTCAAAGGTTGCAACTCTAACTGGCCACAGCATGCGAGTGCTATACCTTGCAATGTCTCCTGATGGCCAGACAATAGTAACTGGTGCAGGAGATGAGACTCTACGGTTTTGGAATGTTTTCCCATCAATGAAAGCACCTGTCCCGGTTAAAGATACAGGCCTTTGGTCACTGGGGCGCACACAAATTCGATGA
Predicted protein sequences of Glyma18g04240
>Glyma18g04240.1   sequence type=predicted peptide   gene model=Glyma18g04240   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAKKSGLNLPAGMSGTSLRLDTAAASSISTLNSPSSLRSISNLTSPSKSNSACSDRFIPCRSSSRLHTFGLLDRPSPVKEGSNEAYSRLLKSELFGSDFASPSLSLSSPAGAAPPSPLSPSKNMLRFKTDHSVAPSSPYSPSILGQQNAFPSDSSTPPPKPPRKVLKTPHKVLDAPSLQDDFYLNLVDWSTQNVLAVGLGTCVYLWSASNSKVTKLCDLGPYDGVCSVQWTREGSFISIGTNLGQVQVWDGTQCKKVRTMGGHQTRTGVLAWNSRILASGSRDRNILQHDMRIPGDFVSKLVGHKSEVCGLKWSSDDRELASGGNDNQLLVWNQHSQQPVLRLTEHTAAVKAIAWSPHQSSLLVSGGGTADRCIRFWNTTNGHQLNCLDTGSQVCNLAWSKNVNELVSTHGYSQNQIMVWKYPSLSKVATLTGHSMRVLYLAMSPDGQTIVTGAGDETLRFWNVFPSMKAPVPVKDTGLWSLGRTQIR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo