Warning : Undefined variable $sxsome in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $sstart in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : Undefined variable $send in
/var/www/html/include/SeqFeatClass.php on line
665
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g03970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1018
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1019
Warning : get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g03970): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in
/var/www/html/include/SeqFeatClass.php on line
1020
Warning : Trying to access array offset on false in
/var/www/html/include/SeqFeatClass.php on line
1021
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1025
Deprecated : preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in
/var/www/html/include/SeqFeatClass.php on line
1031
Report for Sequence Feature Glyma18g03970
Feature Type: gene_model
Chromosome: Gm18
Start: 2744616
stop: 2747751
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g03970
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G44920 AT
Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr2:18524419-18526502 FORWARD LENGTH=224
SoyBase E_val: 7.00E-102 ISS
GO:0006098 GO-bp
Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt
SoyBase N/A ISS
GO:0006636 GO-bp
Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process
SoyBase N/A ISS
GO:0009409 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to cold
SoyBase N/A ISS
GO:0015979 GO-bp
Annotation by Michelle Graham. GO Biological Process: photosynthesis
SoyBase N/A ISS
GO:0015995 GO-bp
Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process
SoyBase N/A ISS
GO:0016117 GO-bp
Annotation by Michelle Graham. GO Biological Process: carotenoid biosynthetic process
SoyBase N/A ISS
GO:0019288 GO-bp
Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway
SoyBase N/A ISS
GO:0042742 GO-bp
Annotation by Michelle Graham. GO Biological Process: defense response to bacterium
SoyBase N/A ISS
GO:0043085 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009534 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid
SoyBase N/A ISS
GO:0009535 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane
SoyBase N/A ISS
GO:0009543 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid lumen
SoyBase N/A ISS
GO:0009579 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid
SoyBase N/A ISS
GO:0031977 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: thylakoid lumen
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
GO:0005515 GO-mf
Annotation by Michelle Graham. GO Molecular Function: protein binding
SoyBase N/A ISS
PTHR14136 Panther
FAMILY NOT NAMED
JGI ISS
PF00805 PFAM
Pentapeptide repeats (8 copies)
JGI ISS
UniRef100_C6SWP1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWP1_SOYBN
SoyBase E_val: 7.00E-156 ISS
UniRef100_O22160 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Thylakoid lumenal 15 kDa protein 1, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=TL15A_ARATH
SoyBase E_val: 3.00E-99 ISS
Expression Patterns of Glyma18g03970
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g03970
Paralog Evidence Comments
Glyma11g34350 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g03970 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g035300 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g03970
Transcripts of Glyma18g03970
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g03970.2 sequence type=transcript gene model=Glyma18g03970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
TGATCCTGAGACCGAGCAACATTATCCACATCCACATGGTACCTATGACACTTTGCCGTCGTGAGTTGCATCTGCGTGTGACTGCAAGAAATGGCTCTTGTTCTCAACGTCTCATTGTGTTCCATTTCTAAACCCCATCTTTCTCTCTCAACCTCCAATCCCAACAAAGCTTCTTCAACTCTTCCTCTTCCTATTCTGGGACTTAAAACAAAGCAAAGTCTCCAACCATCTCAGAAACTCACATTTTCATTGGGTGAATCAGTGGCTGGTGCCACCCTCGTTGCTCTCCTCTCTGCTTCTTTCATCTTTGTTGATCCCGCACTTGCATTCAAGGGTGGAGGGCCATACGGGCAGGAAGTGACAAGGGGACAAGATCTCACTGGGAAGGACTTTAGTGGCAAGACTCTGATCAAACAAGACTTCAAAACGTCCATACTGAGACAAGCCAATTTTAAAGGTGCAAAGTTAATAGGTGCTAGCTTCTTTGATGCTGATTTAACAGGTGCTGACCTTTCGGATGCTGATCTTAGAAATGCAGATTTTTCCCTGGCAAATGTGACAAAGGCAAATTTAAGCAATGCTAACTTGGAAGGTGCACTTGCAACAGGAAACACTTCTTTTAGGGGATCAAATGTTACAGGCGCTGGTATTAGTAATATCACTTAAACTATAATGTGCTACTATTGGGCTTTTAAGCGAAATATGGTTGTAAAAGAGTGTATGTATCTGATAATAGCTTTCAACTAATTAAAGGACATAACATTGGTATTGGCTGGTGATTAATTAACTAATCTATAGGTCCACAATTAAAGG
Coding sequences of Glyma18g03970
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g03970.1 sequence type=CDS gene model=Glyma18g03970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCTTGTTCTCAACGTCTCATTGTGTTCCATTTCTAAACCCCATCTTTCTCTCTCAACCTCCAATCCCAACAAAGCTTCTTCAACTCTTCCTCTTCCTATTCTGGGACTTAAAACAAAGCAAAGTCTCCAACCATCTCAGAAACTCACATTTTCATTGGGTGAATCAGTGGCTGGTGCCACCCTCGTTGCTCTCCTCTCTGCTTCTTTCATCTTTGTTGATCCCGCACTTGCATTCAAGGGTGGAGGGCCATACGGGCAGGAAGTGACAAGGGGACAAGATCTCACTGGGAAGGACTTTAGTGGCAAGACTCTGATCAAACAAGACTTCAAAACGTCCATACTGAGACAAGCCAATTTTAAAGGTGCAAAGTTAATAGGTGCTAGCTTCTTTGATGCTGATTTAACAGGTGCTGACCTTTCGGATGCTGATCTTAGAAATGCAGATTTTTCCCTGGCAAATGTGACAAAGGCAAATTTAAGCAATGCTAACTTGGAAGGTGCACTTGCAACAGGAAACACTTCTTTTAGGGGATCAAATGTTACAGGCGCTGACTTCACGGATGTACCACTAAGAGAAGATCAACGTGAATACCTCTGCAAAGTTGCTGATGGAGTGAACCCAACAACTGGAAATGCTACACGTGATACATTGTTCTGTAATTAG
>Glyma18g03970.2 sequence type=CDS gene model=Glyma18g03970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTCTTGTTCTCAACGTCTCATTGTGTTCCATTTCTAAACCCCATCTTTCTCTCTCAACCTCCAATCCCAACAAAGCTTCTTCAACTCTTCCTCTTCCTATTCTGGGACTTAAAACAAAGCAAAGTCTCCAACCATCTCAGAAACTCACATTTTCATTGGGTGAATCAGTGGCTGGTGCCACCCTCGTTGCTCTCCTCTCTGCTTCTTTCATCTTTGTTGATCCCGCACTTGCATTCAAGGGTGGAGGGCCATACGGGCAGGAAGTGACAAGGGGACAAGATCTCACTGGGAAGGACTTTAGTGGCAAGACTCTGATCAAACAAGACTTCAAAACGTCCATACTGAGACAAGCCAATTTTAAAGGTGCAAAGTTAATAGGTGCTAGCTTCTTTGATGCTGATTTAACAGGTGCTGACCTTTCGGATGCTGATCTTAGAAATGCAGATTTTTCCCTGGCAAATGTGACAAAGGCAAATTTAAGCAATGCTAACTTGGAAGGTGCACTTGCAACAGGAAACACTTCTTTTAGGGGATCAAATGTTACAGGCGCTGGTATTAGTAATATCACTTAA
Predicted protein sequences of Glyma18g03970
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g03970.1 sequence type=predicted peptide gene model=Glyma18g03970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MALVLNVSLCSISKPHLSLSTSNPNKASSTLPLPILGLKTKQSLQPSQKLTFSLGESVAGATLVALLSASFIFVDPALAFKGGGPYGQEVTRGQDLTGKDFSGKTLIKQDFKTSILRQANFKGAKLIGASFFDADLTGADLSDADLRNADFSLANVTKANLSNANLEGALATGNTSFRGSNVTGADFTDVPLREDQREYLCKVADGVNPTTGNATRDTLFCN*
>Glyma18g03970.2 sequence type=predicted peptide gene model=Glyma18g03970 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MALVLNVSLCSISKPHLSLSTSNPNKASSTLPLPILGLKTKQSLQPSQKLTFSLGESVAGATLVALLSASFIFVDPALAFKGGGPYGQEVTRGQDLTGKDFSGKTLIKQDFKTSILRQANFKGAKLIGASFFDADLTGADLSDADLRNADFSLANVTKANLSNANLEGALATGNTSFRGSNVTGAGISNIT*