SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g02820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g02820): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g02820

Feature Type:gene_model
Chromosome:Gm18
Start:1836871
stop:1840446
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40290AT Annotation by Michelle Graham. TAIR10: Eukaryotic translation initiation factor 2 subunit 1 | chr2:16829030-16830889 REVERSE LENGTH=344 SoyBaseE_val: 0ISS
GO:0009165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleotide biosynthetic process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005850GO-cc Annotation by Michelle Graham. GO Cellular Compartment: eukaryotic translation initiation factor 2 complex SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0003743GO-mf Annotation by Michelle Graham. GO Molecular Function: translation initiation factor activity SoyBaseN/AISS
KOG2916 KOG Translation initiation factor 2, alpha subunit (eIF-2alpha) JGI ISS
PTHR10602Panther EUKARYOTIC TRANSLATION INITIATION FACTOR 2 JGI ISS
PF00575PFAM S1 RNA binding domain JGI ISS
PF07541PFAM Eukaryotic translation initiation factor 2 alpha subunit JGI ISS
UniRef100_I1MZ01UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MZ01_SOYBN SoyBaseE_val: 0ISS
UniRef100_Q9C5N6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein synthesis initiation factor eIF2 alpha n=1 Tax=Arabidopsis thaliana RepID=Q9C5N6_ARATH SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g02820 not represented in the dataset

Glyma18g02820 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g35600 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g024800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g02820.1   sequence type=CDS   gene model=Glyma18g02820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTCCGAACCTTGAATGTCGTATGTACGAAGCGAAGTACCCGGAGGTGGACATGGCGGTGATGATACAGGTGAAGAACATAGCGGACATGGGGGCGTACGTGTCGCTGCTGGAGTACAACAACATCGAGGGCATGATCTTGTTCTCGGAGCTCTCTCGCCGTCGTATTCGGAGTGTGAGCAGCCTCATCAAGGTTGGCCGCATCGAGCCGGTGATGGTGCTCCGTGTCGACAAGGAAAAGGGTTACATCGATCTCAGCAAGCGCAGGGTCTCCGAAGAGGACATCCAGGCCTGCGAGGAGAGGTACAACAAGAGCAAGCTCGTCCACTCCATCATGCGCCACGTCGCTGAAACCCTCAACATCGATTTGGAGGAGCTCTATATTCACATTGGATGGCCTTTGTATCGCAAATATGGTCACGCTTTCGAGGCTTTCAAAATAATTGTGACTGATCCTGATACTGTTTTAAGTACTCTCACTCGTGAAGTTAAGGAAGTTGGCCCTGATGGGCAAGAGGTGACTAGTGTGGTGCCAGCTGTATCAGAAGAAGTGAAGGACTCTCTTGTGAAGAATATTAGAAGACGAATGACCCCCCAACCCTTGAAAATTAGGGCAGATATTGAAATGAAATGTTTTCAATTTGATGGAGTTCTTCACATTAAGGAGGCAATGCGTAAGGCTGAAGCTGTGGGAAATGATGACTGCCCTGTCAAAATTAAACTTGTTGCTCCCCCACTTTATGTTCTTACCACCCAGACACTGGACAAGGAGCAAGGAATATTGGTTCTCAACAATGCCATAGCTTCTTGCACTGAAGCAATAGAACAACACAAGGGTAAACTTGTGGTTAAGGAGGCAGCTAGAGCAGTGAGTGAACGTGATGATAAATTGCTTGCCGAGCACATGGCTAAGCTACGCCAAGATAATGAAGAGGTCAGTGGTGATGAAGACAGTGAGGAGGAAGAAGATACAGGAATGGGCGAGGTTGATGTGGATAATGGTGCCGGGATAACAGAGTGA

>Glyma18g02820.1   sequence type=predicted peptide   gene model=Glyma18g02820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAPNLECRMYEAKYPEVDMAVMIQVKNIADMGAYVSLLEYNNIEGMILFSELSRRRIRSVSSLIKVGRIEPVMVLRVDKEKGYIDLSKRRVSEEDIQACEERYNKSKLVHSIMRHVAETLNIDLEELYIHIGWPLYRKYGHAFEAFKIIVTDPDTVLSTLTREVKEVGPDGQEVTSVVPAVSEEVKDSLVKNIRRRMTPQPLKIRADIEMKCFQFDGVLHIKEAMRKAEAVGNDDCPVKIKLVAPPLYVLTTQTLDKEQGILVLNNAIASCTEAIEQHKGKLVVKEAARAVSERDDKLLAEHMAKLRQDNEEVSGDEDSEEEEDTGMGEVDVDNGAGITE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo