SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g02590

Feature Type:gene_model
Chromosome:Gm18
Start:1640573
stop:1645288
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g02590
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G56190AT Annotation by Michelle Graham. TAIR10: alpha-soluble NSF attachment protein 2 | chr3:20846119-20848356 REVERSE LENGTH=289 SoyBaseE_val: 3.00E-154ISS
GO:0006886GO-bp Annotation by Michelle Graham. GO Biological Process: intracellular protein transport SoyBaseN/AISS
GO:0005773GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuole SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005483GO-mf Annotation by Michelle Graham. GO Molecular Function: soluble NSF attachment protein activity SoyBaseN/AISS
KOG1586 KOG Protein required for fusion of vesicles in vesicular transport, alpha-SNAP JGI ISS
PTHR13768Panther SOLUBLE NSF ATTACMENT PROTEIN (SNAP) JGI ISS
UniRef100_B7FHQ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alpha-soluble NSF attachment protein n=1 Tax=Medicago truncatula RepID=B7FHQ2_MEDTR SoyBaseE_val: 0ISS
UniRef100_I1MYX8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYX8_SOYBN SoyBaseE_val: 0ISS

Expression Patterns of Glyma18g02590
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g02590
ParalogEvidenceComments
Glyma11g35820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g02590 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g022500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g02590
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g02590
>Glyma18g02590.1   sequence type=CDS   gene model=Glyma18g02590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGATCAGTTATCGAAGGGAGAGGAATTCGAGAAAAAGGCTGAGAAGAAGCTCAGCGGTTGGGGCTTGTTTGGCTCCAAGTATGAAGATGCCGCCGATCTCTTCGATAAAGCCGCCAATTGCTTCAAGCTCGCCAAATCATGGGACAAGGCTGGAGCGACATACCTGAAGTTGGCAAGTTGTCATTTGAAGTTGGAAAGCAAGCATGAAGCTGCACAGGCCCATGTCGATGCTGCACATTGCTACAAAAAGACTAATATAAACGAGTCTGTATCTTGCTTAGACCGAGCTGTAAATCTTTTCTGTGACATTGGAAGACTCTCTATGGCTGCTAGATATTTAAAGGAAATTGCTGAATTGTACGAGGGTGAACAGAATATTGAGCAGGCTCTTGTTTACTATGAAAAATCAGCTGATTTTTTTCAAAATGAAGAAGTGACAACTTCTGCGAACCAATGCAAACAAAAAGTTGCCCAGTTTGCTGCTCAGCTAGAACAATATCAGAAGTCGATTGACATTTATGAAGAGATAGCTCGCCAATCCCTCAACAATAATTTGCTGAAGTATGGAGTTAAAGGACACCTTCTTAATGCTGGCATCTGCCAACTCTGTAAAGAGGACGTTGTTGCTATAACCAATGCATTAGAACGATATCAGGAACTGGATCCAACATTTTCAGGAACACGTGAATATAGATTGTTGGCGGACATTGCTGCTGCAATTGATGAAGAAGATGTTGCAAAGTTTACTGATGTTGTCAAGGAATTTGATAGTATGACCCCTCTGGATTCTTGGAAGACCACACTTCTCTTAAGGGTGAAGGAAAAGCTGAAAGCCAAAGAACTTGAGGAGGATGATCTTACTTGA
Predicted protein sequences of Glyma18g02590
>Glyma18g02590.1   sequence type=predicted peptide   gene model=Glyma18g02590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADQLSKGEEFEKKAEKKLSGWGLFGSKYEDAADLFDKAANCFKLAKSWDKAGATYLKLASCHLKLESKHEAAQAHVDAAHCYKKTNINESVSCLDRAVNLFCDIGRLSMAARYLKEIAELYEGEQNIEQALVYYEKSADFFQNEEVTTSANQCKQKVAQFAAQLEQYQKSIDIYEEIARQSLNNNLLKYGVKGHLLNAGICQLCKEDVVAITNALERYQELDPTFSGTREYRLLADIAAAIDEEDVAKFTDVVKEFDSMTPLDSWKTTLLLRVKEKLKAKELEEDDLT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo