SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g02321): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g02321): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g02321

Feature Type:gene_model
Chromosome:Gm18
Start:1468326
stop:1470479
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G65180AT Annotation by Michelle Graham. TAIR10: ENTH/VHS family protein | chr5:26045625-26047806 FORWARD LENGTH=439 SoyBaseE_val: 5.00E-100ISS
GO:0007059GO-bp Annotation by Michelle Graham. GO Biological Process: chromosome segregation SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0031048GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA SoyBaseN/AISS
GO:0032204GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of telomere maintenance SoyBaseN/AISS
GO:0032504GO-bp Annotation by Michelle Graham. GO Biological Process: multicellular organism reproduction SoyBaseN/AISS
GO:0033044GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of chromosome organization SoyBaseN/AISS
GO:0042138GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic DNA double-strand break formation SoyBaseN/AISS
GO:0043247GO-bp Annotation by Michelle Graham. GO Biological Process: telomere maintenance in response to DNA damage SoyBaseN/AISS
GO:0045132GO-bp Annotation by Michelle Graham. GO Biological Process: meiotic chromosome segregation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR12460Panther UNCHARACTERIZED JGI ISS
PF04818PFAM Protein of unknown function, DUF618 JGI ISS
UniRef100_G7J4E0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Regulation of nuclear pre-mRNA domain-containing protein 1B n=1 Tax=Medicago truncatula RepID=G7J4E0_MEDTR SoyBaseE_val: 1.00E-109ISS
UniRef100_I1LMZ3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LMZ3_SOYBN SoyBaseE_val: 5.00E-138ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g02321 not represented in the dataset

Glyma18g02321 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g36110 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g02321.1   sequence type=CDS   gene model=Glyma18g02321   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACGTAAGTTGTTGTCTTTAACGTTTGATATAGCTTTATCACATTGGTGTATATTTCACCGGAGCAAAGAAGAACTGGTTGTTGCCACTTGGAAAAAACAATTTGACAAATCAGAGATGATTCAAAGGGTCCTCCTTCTGTATCTTGCAAATGACATTCTGCAGAACTGTAAGCGTAAAGGGAATGAATTTGTGACAGAGTTTTGGAAGGTTCTTCCTGCAGCACTTAAAGATGTTATCAAGAAAGGTGATGATCATGGAAAGCGTGTGGTATCTACATTGATTGAAATATGGGAGCAAAGGAGAGTGTTTGGATCCCAGGCTAGGAACCTTAAAGATTTGATGCTTGGAGAAGATGCACCTCCACCATTGGAATTTGGCAAAAAGCGATCACGTTCTGTAAGAATTGCGAAAAGGGATTCTCACTCCATCAAATCGAAACTGTCCATAGGAGGTACAGCAGAAAAAATAGTGTCTGCATTTCATTTGGTGCTCAGTGAGCAATCCGCTGAAGATGCAGAGATGAGTAAGTGCAAATCTTCTGTTCAGCGTGTGAGGAAGTTGGAAAAAGATGTTGATACCGCGTGCTCTGTTGACAAAGATCCTAAGAGAAATACTTTAGCAAAGGAACTAGAGGAGGAGGAAAATGTTTTGAAACAATGCATAGAAAACTTAAATTAG

>Glyma18g02321.1   sequence type=predicted peptide   gene model=Glyma18g02321   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQRKLLSLTFDIALSHWCIFHRSKEELVVATWKKQFDKSEMIQRVLLLYLANDILQNCKRKGNEFVTEFWKVLPAALKDVIKKGDDHGKRVVSTLIEIWEQRRVFGSQARNLKDLMLGEDAPPPLEFGKKRSRSVRIAKRDSHSIKSKLSIGGTAEKIVSAFHLVLSEQSAEDAEMSKCKSSVQRVRKLEKDVDTACSVDKDPKRNTLAKELEEEENVLKQCIENLN*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo