Glyma18g01500 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g01500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g01500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g01500

Feature Type:	gene_model
Chromosome:	Gm18
Start:	808410
stop:	816587
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g01500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G67730	AT	Annotation by Michelle Graham. TAIR10: beta-ketoacyl reductase 1 \| chr1:25391676-25393365 FORWARD LENGTH=318	SoyBase	E_val: 4.00E-105	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009790	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0042761	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0046520	GO-bp	Annotation by Michelle Graham. GO Biological Process: sphingoid biosynthetic process	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0018454	GO-mf	Annotation by Michelle Graham. GO Molecular Function: acetoacetyl-CoA reductase activity	SoyBase	N/A	ISS
GO:0045703	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ketoreductase activity	SoyBase	N/A	ISS
KOG1014	KOG	17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3	JGI		ISS
PTHR24316	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24316:SF38	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00106	PFAM	short chain dehydrogenase	JGI		ISS
UniRef100_G7J2K2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Estradiol 17-beta-dehydrogenase n=1 Tax=Medicago truncatula RepID=G7J2K2_MEDTR	SoyBase	E_val: 6.00E-169	ISS
UniRef100_I1MYK8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYK8_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma18g01500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g01500 not represented in the dataset	Glyma18g01500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma18g01500 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g011500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g01500

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g01500

Limit To All Plant Sequences

>Glyma18g01500.1   sequence type=CDS   gene model=Glyma18g01500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGGGCTTGATTTGTTCCTAGTAGCAACGAATACCATAGGCTTCATTTGTGTGTGCAGTGCCCTTATCAAATTTCTCAAGTGGGTATGGGTGGTGTTCTTGAGGCCACCAAAGAATCTCAAAGAGTATGGTTCATGGGCCATAATCACTGGCTCCACTGATGGAATTGGCAAGGCCATGGCTTTTGAATTGGCATCTAAGGGACTTAACCTTCTCTTGGTTGGTAGAAACCCTCTAAAACTTGAGGCAACATCCAAGGAAATAAGAGATAGACTTGATGTTGAGGTTAAGTTTGTGGTCATAGACATGCAAAAAGTTGAGGGAGTTGAAATAGTAAAAAAAGTAGAGGAAGCAATAGATGGATTGGATATAGGTTTGCTAGTTAATGGTGCAGGCTTGGCTTACCCTTATGCTAGATTCTTTCATGAGGTTGATTTGGAGCTTATGGATGCTATTATAAAAGTAAACTTGGAGGGAGCAACTTGGATCACAAAGGCAGTGCTTCCCACTATGATCAAGAAGAAAAAGGGAGCAATAGTGAACATTGGCTCTGGTTCCACTGTTGTGCTTCCTTCATATCCTCTAGTCACCCTCTATGCTGCTACAAAAGCATACCTTGCAATGTTCTCGAGATGCATCAGTTTGGAATACAAGCATCAAGGAATTGACATCCAATGTCAGGTTCCATTATTTGTATCAACAAAGATGACCAAAATGAAGACATCAATTTTTGTTCCAACGCCGGCTATGTATAGTAAAACATGCACAAGATGGATTGGATACGAAAAACTGGTTGAGCCATACTTCCTCCATTCTGTGCAGGGGTTTCTCATAAGGGCAATTCCTGATTCATTAGTGGATTCCTATATGCTGCGCTATTTTCTTTATTGGCGTGGAAGAGGACTCTCCAAGGACTCCAACATTAAAACATCAGCAGCATCTAATTCTGAAGAAGCAAACATCATTAATCAAGATCATACAAATTAA

Predicted protein sequences of Glyma18g01500

Limit To All Plant Sequences

>Glyma18g01500.1   sequence type=predicted peptide   gene model=Glyma18g01500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEGLDLFLVATNTIGFICVCSALIKFLKWVWVVFLRPPKNLKEYGSWAIITGSTDGIGKAMAFELASKGLNLLLVGRNPLKLEATSKEIRDRLDVEVKFVVIDMQKVEGVEIVKKVEEAIDGLDIGLLVNGAGLAYPYARFFHEVDLELMDAIIKVNLEGATWITKAVLPTMIKKKKGAIVNIGSGSTVVLPSYPLVTLYAATKAYLAMFSRCISLEYKHQGIDIQCQVPLFVSTKMTKMKTSIFVPTPAMYSKTCTRWIGYEKLVEPYFLHSVQGFLIRAIPDSLVDSYMLRYFLYWRGRGLSKDSNIKTSAASNSEEANIINQDHTN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain