SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g01040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g01040): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g01040

Feature Type:gene_model
Chromosome:Gm18
Start:513587
stop:514524
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43250AT Annotation by Michelle Graham. TAIR10: nuclear factor Y, subunit C13 | chr5:17356174-17356566 REVERSE LENGTH=130 SoyBaseE_val: 2.00E-46ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0043565GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding SoyBaseN/AISS
PTHR10252Panther HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED JGI ISS
PF00808PFAM Histone-like transcription factor (CBF/NF-Y) and archaeal histone JGI ISS
UniRef100_G7JC00UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transcription factor Y subunit C-4 n=1 Tax=Medicago truncatula RepID=G7JC00_MEDTR SoyBaseE_val: 3.00E-50ISS
UniRef100_I1MYF9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYF9_SOYBN SoyBaseE_val: 1.00E-111ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g01040 not represented in the dataset

Glyma18g01040 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g37130 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g007100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g01040.1   sequence type=CDS   gene model=Glyma18g01040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTATGGCGGAGGAAGAAGAAAGCGGAGTATCGATACAACTGGAATTCCCGAAGGGTCGGGTGAAGAAGATTATGGCGCTGGACAAAGACGTGAAGAGGGTGAGCTCAGAAGCGTTGTTTCTGGTGTCGCGCTCCACGGAATTATTCCTCCAATTCCTGGCTGAAAAATCGGCGCAGGTTGCGATTGAAAAGAAACGGAAGACCGTGAATCTGGAACATATAAGAGAGGCCGTGAAGAGGCACCAGCCAACCAGGGATTTTCTCCTCGATGAGCTTCCGCCGCCATCTCAGCCCACCAAGCCCGATAGGCCCACTCAGCCTGCCGGTCGGCCCAAATTGGATCCTCCTCCCCGTGGTACTCGCCGCATCGATCTATTTTTCCGGAAACCAGAACTTGACGACCCAGCCCAAGCCCAACCACCTGAAAATCCAGCTCAAGCTCAACCGCCTGAAAATCCAGACCAAGACCAAGCCCAATCGCCAGTACCCGTAGATGAGTCTTAG

>Glyma18g01040.1   sequence type=predicted peptide   gene model=Glyma18g01040   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVMAEEEESGVSIQLEFPKGRVKKIMALDKDVKRVSSEALFLVSRSTELFLQFLAEKSAQVAIEKKRKTVNLEHIREAVKRHQPTRDFLLDELPPPSQPTKPDRPTQPAGRPKLDPPPRGTRRIDLFFRKPELDDPAQAQPPENPAQAQPPENPDQDQAQSPVPVDES*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo