Glyma18g01030 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g01030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g01030): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g01030

Feature Type:	gene_model
Chromosome:	Gm18
Start:	509448
stop:	513253
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g01030

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G27390	AT	Annotation by Michelle Graham. TAIR10: translocase outer membrane 20-2 \| chr1:9513469-9514912 REVERSE LENGTH=210	SoyBase	E_val: 1.00E-80	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0045040	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial outer membrane	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005741	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane	SoyBase	N/A	ISS
GO:0005742	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial outer membrane translocase complex	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005744	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane presequence translocase complex	SoyBase	N/A	ISS
GO:0022626	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosolic ribosome	SoyBase	N/A	ISS
GO:0015450	GO-mf	Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity	SoyBase	N/A	ISS
GO:0046872	GO-mf	Annotation by Michelle Graham. GO Molecular Function: metal ion binding	SoyBase	N/A	ISS
PTHR10790	Panther	UDP-N-ACETYLGLUCOSAMINE--PEPTIDE N-ACETYLGLUCOSAMINYLTRANSFERASE SUBUNIT-RELATED	JGI		ISS
PTHR10790:SF9	Panther	SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT (TPR) CONTAINING PROTEIN	JGI		ISS
PF06552	PFAM	Plant specific mitochondrial import receptor subunit TOM20	JGI		ISS
UniRef100_B9RMF2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import receptor subunit TOM20, putative n=1 Tax=Ricinus communis RepID=B9RMF2_RICCO	SoyBase	E_val: 2.00E-95	ISS
UniRef100_UPI000233F0EE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F0EE related cluster n=1 Tax=unknown RepID=UPI000233F0EE	SoyBase	E_val: 2.00E-145	ISS

Expression Patterns of Glyma18g01030

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g01030 not represented in the dataset	Glyma18g01030 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g01030

Paralog	Evidence	Comments
Glyma11g37120	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g01030 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g007000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g01030

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma18g01030

Limit To All Plant Sequences

>Glyma18g01030.3   sequence type=transcript   gene model=Glyma18g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CAGGAGGTGCAGTTGCAGAGTTTAACGTTTGGCCATCACAGAAGGGGGAATGGAGTTTTCTCAAGATGATTTTGATCGGTTACTGTTATTCGAGCACACGCGAAAGAGCGCTGAAGCAAACTACGCAGAGAATCCTCTAGACGCTGATAATCTGACCAAGTGGGGGGGAGCTTTGATCGAGTTGTCATCGTTCCAAGCTCCTAAGGATGCCAAGGCGATGATTGATGGTATATCACGTGTTGAATTGAGCAAAATGTAAAAGTGAATTTCTGTTTTCGAGAAGGTAAGGGCGAGTTACTGTGATTGATTTTGGGATTTGGTGGGAACCAACCAACTAAACAGATGCCCTTTCAAAGCTGGAGGAGGCTTTGCTGATCAATCCAACTAAGCATGACACTCTTTGGTGCTTGGGAAATGCAAACACGTCTTATGCTTTTCTAATCCCTGATATCACTGAGGCAAAGGGTTATTTTGACAAGGCACTTGATTATTTCCAGAAAGCTGTGGATGAGGATCCTGAGAATGACCTCTATAGAAAGTCCTTGCAAGTTGCCATTAAGGCCCCAGAACTACACATGGAGATCCATAAAAATGGGCTTGGTCTGATGAGTAATGCGGGATCCTCTGCTACTTCAAAAGAAAAGGTTGTATATATTGAAATTTCATTGCATTTAATTAAATTTTAGTCACGTACTTACAAATACTAATTGATCACTATAAATCAACTTCAATCTGCTATGTCAAGTTAACAGAAGTCGCTTCTTGATGATTTTAAAATGCTCAAAGCAGCATGAAG

Coding sequences of Glyma18g01030

Limit To All Plant Sequences

>Glyma18g01030.2   sequence type=CDS   gene model=Glyma18g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTTTCTCAAGATGATTTTGATCGGTTACTGTTATTCGAGCACACGCGAAAGAGCGCTGAAGCAAACTACGCAGAGAATCCTCTAGACGCTGATAATCTGACCAAGTGGGGGGGAGCTTTGATCGAGTTGTCATCGTTCCAAGCTCCTAAGGATGCCAAGGCGATGATTGATGATGCCCTTTCAAAGCTGGAGGAGGCTTTGCTGATCAATCCAACTAAGCATGACACTCTTTGGTGCTTGGGAAATGCAAACACGTCTTATGCTTTTCTAATCCCTGATATCACTGAGGCAAAGGGTTATTTTGACAAGGCACTTGATTATTTCCAGAAAGCTGTGGATGAGGATCCTGAGAATGACCTCTATAGAAAGTCCTTGCAAGTTGCCATTAAGGCCCCAGAACTACACATGGAGATCCATAAAAATGGGCTTGGTCTGATGAGTAATGCGGGATCCTCTGCTACTTCAAAAGAAAAGGAATCTAAAAGGCAGAAGAGCAATGACTTTAAGTATGACATATTTGGATGGATTATTCTTGCAGTGGGTATAGTAGCATGGGTGGGAATGGCCAAATCTAACATTCCCCCGCCACCTCCAAGATAA

>Glyma18g01030.3   sequence type=CDS   gene model=Glyma18g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTTTCTCAAGATGATTTTGATCGGTTACTGTTATTCGAGCACACGCGAAAGAGCGCTGAAGCAAACTACGCAGAGAATCCTCTAGACGCTGATAATCTGACCAAGTGGGGGGGAGCTTTGATCGAGTTGTCATCGTTCCAAGCTCCTAAGGATGCCAAGGCGATGATTGATGGTATATCACGTGTTGAATTGAGCAAAATGTAA

Predicted protein sequences of Glyma18g01030

Limit To All Plant Sequences

>Glyma18g01030.2   sequence type=predicted peptide   gene model=Glyma18g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFSQDDFDRLLLFEHTRKSAEANYAENPLDADNLTKWGGALIELSSFQAPKDAKAMIDDALSKLEEALLINPTKHDTLWCLGNANTSYAFLIPDITEAKGYFDKALDYFQKAVDEDPENDLYRKSLQVAIKAPELHMEIHKNGLGLMSNAGSSATSKEKESKRQKSNDFKYDIFGWIILAVGIVAWVGMAKSNIPPPPPR*

>Glyma18g01030.3   sequence type=predicted peptide   gene model=Glyma18g01030   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEFSQDDFDRLLLFEHTRKSAEANYAENPLDADNLTKWGGALIELSSFQAPKDAKAMIDGISRVELSKM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain