SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G27970 | AT | Annotation by Michelle Graham. TAIR10: nuclear transport factor 2B | chr1:9746921-9747787 FORWARD LENGTH=126 | SoyBase | E_val: 2.00E-47 | ISS |
| GO:0006606 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into nucleus | SoyBase | N/A | ISS |
| GO:0006612 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane | SoyBase | N/A | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0006820 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anion transport | SoyBase | N/A | ISS |
| GO:0006862 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleotide transport | SoyBase | N/A | ISS |
| GO:0006888 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ER to Golgi vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0006913 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport | SoyBase | N/A | ISS |
| GO:0010363 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response | SoyBase | N/A | ISS |
| GO:0015696 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ammonium transport | SoyBase | N/A | ISS |
| GO:0015802 | GO-bp | Annotation by Michelle Graham. GO Biological Process: basic amino acid transport | SoyBase | N/A | ISS |
| GO:0016192 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport | SoyBase | N/A | ISS |
| GO:0043069 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death | SoyBase | N/A | ISS |
| GO:0043090 | GO-bp | Annotation by Michelle Graham. GO Biological Process: amino acid import | SoyBase | N/A | ISS |
| GO:0043269 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of ion transport | SoyBase | N/A | ISS |
| GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005635 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0008536 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: Ran GTPase binding | SoyBase | N/A | ISS |
| GO:0008565 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein transporter activity | SoyBase | N/A | ISS |
| PTHR12612 | Panther | NUCLEAR TRANSPORT FACTOR 2 | JGI | ISS | |
| PF02136 | PFAM | Nuclear transport factor 2 (NTF2) domain | JGI | ISS | |
| UniRef100_G7JBF4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Nuclear transport factor n=1 Tax=Medicago truncatula RepID=G7JBF4_MEDTR | SoyBase | E_val: 1.00E-48 | ISS |
| UniRef100_UPI000233E2DB | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233E2DB related cluster n=1 Tax=unknown RepID=UPI000233E2DB | SoyBase | E_val: 1.00E-58 | ISS |
|
Glyma18g00861 not represented in the dataset |
Glyma18g00861 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma11g36950 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma18g00861.1 sequence type=CDS gene model=Glyma18g00861 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTCTCTTTCGAGGCTCAGAAGATCCTGGGCGCCCCCAACATCCTCGCCAAACTCACTTCCCTTCCCTTCCAACAGTGCCAGCACTCCATCACCACCGTCGATTCCCAGCCCTCCGCTGTCAACTCCGCCATGCTCGTCTTCGTCAGCGGCAACCTCCAGCTCGCCGGCGAACAACACTCCCTTAAGTTTAGCCAAATGTTCCATTTGATACCAACACCACAGGGAAGCTATTATGTGTTGAATGACATATTCCGGTTGAACTATGCGTGA
>Glyma18g00861.1 sequence type=predicted peptide gene model=Glyma18g00861 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLSFEAQKILGAPNILAKLTSLPFQQCQHSITTVDSQPSAVNSAMLVFVSGNLQLAGEQHSLKFSQMFHLIPTPQGSYYVLNDIFRLNYA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
