SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g00820

Feature Type:gene_model
Chromosome:Gm18
Start:384277
stop:387005
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma18g00820
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G27290AT Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; EXPRESSED IN: 25 plant structures; EXPRESSED DURING: 15 growth stages; Has 44 Blast hits to 44 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 44; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:9481788-9482576 FORWARD LENGTH=142 SoyBaseE_val: 5.00E-47ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1MYD5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1MYD5_SOYBN SoyBaseE_val: 1.00E-83ISS
UniRef100_Q9FZK6UniRef Annotation by Michelle Graham. Most informative UniRef hit: F17L21.8 n=1 Tax=Arabidopsis thaliana RepID=Q9FZK6_ARATH SoyBaseE_val: 2.00E-41ISS

Expression Patterns of Glyma18g00820
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g00820
ParalogEvidenceComments
Glyma11g36900 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g00820 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g004900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma18g00820
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma18g00820
>Glyma18g00820.2   sequence type=CDS   gene model=Glyma18g00820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGAGGGGAAGAAGGAGACATCAAGATGAGCAATCTCGTGCTTTGTACGACCTCTCCTCTCTCGTTCTCAACCTCCTTCGCTCGCCTCTGACGTTCTCCGACGAGGTTCCGCCAGCGTCACGGCGTCCGGGCCAGGCTCAGATATCCCCGGCGGGATTCGCGTCGTTGCTGCTGGGAATATCCCTGGCGTTGATGCTGTGTGGATCTGTGACGTTCTTCATCGGGTTCGTGTTGATGCCGTGGGTTCTGGGATTGGTCATGCTCTTCTACGTCGCCGGAATCCTCTCCACCCTCTCCGTCTTCGGCCGCTCCATTCTCTGCTACGCCACCTCCCCACCCTCGCCGCGTAAGGACATTCCCGCATGGAAGCTTATGTGA
Predicted protein sequences of Glyma18g00820
>Glyma18g00820.2   sequence type=predicted peptide   gene model=Glyma18g00820   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMRGRRRHQDEQSRALYDLSSLVLNLLRSPLTFSDEVPPASRRPGQAQISPAGFASLLLGISLALMLCGSVTFFIGFVLMPWVLGLVMLFYVAGILSTLSVFGRSILCYATSPPSPRKDIPAWKLM*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo