SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma18g00760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma18g00760): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma18g00760

Feature Type:gene_model
Chromosome:Gm18
Start:350375
stop:352509
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G07880AT Annotation by Michelle Graham. TAIR10: Immunoglobulin E-set superfamily protein | chr3:2514175-2515544 FORWARD LENGTH=240 SoyBaseE_val: 4.00E-86ISS
GO:0007015GO-bp Annotation by Michelle Graham. GO Biological Process: actin filament organization SoyBaseN/AISS
GO:0009932GO-bp Annotation by Michelle Graham. GO Biological Process: cell tip growth SoyBaseN/AISS
GO:0010053GO-bp Annotation by Michelle Graham. GO Biological Process: root epidermal cell differentiation SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005094GO-mf Annotation by Michelle Graham. GO Molecular Function: Rho GDP-dissociation inhibitor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG3205 KOG Rho GDP-dissociation inhibitor JGI ISS
PTHR10980Panther RHO GDP-DISSOCIATION INHIBITOR-RELATED JGI ISS
PTHR10980:SF2Panther RHO GUANINE DISSOCIATION INHIBITOR-RELATED JGI ISS
PF02115PFAM RHO protein GDP dissociation inhibitor JGI ISS
UniRef100_C6TIP5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TIP5_SOYBN SoyBaseE_val: 3.00E-178ISS
UniRef100_G7JBE1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Rho GDP-dissociation inhibitor n=1 Tax=Medicago truncatula RepID=G7JBE1_MEDTR SoyBaseE_val: 7.00E-102ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma18g00760 not represented in the dataset

Glyma18g00760 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma11g36860 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.18g004300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma18g00760.1   sequence type=CDS   gene model=Glyma18g00760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTGCTGCTGTGTCCTCCACAACCCCTCATTTAGAGGAAGAGCTCAAAAACAAAGCAACAAACAACAAGAAGAAGAACAACGTTGGTGGGGAATCAGACCAGCCCCCTTACAATGATGGTGCCAACTCTGATGTTGCTGAAGAAACTGAGCCAGAGGAAGATGATGACTCCAAGTTGGAATCTAACAAAGATTTGGATCTTGGCCCTCAATTCACTCTCAAGGAACAGCTTGAGAAAGACAAAGATGATGAAAGTTTGAGAAAATGGAAGGAGCAACTTCTGGGAAGTGTTGACATGTCTGTCGTTGGAAGTGAATGCAAAGACCCTGAAGTGAAGATATTGAGCCTCATTATTACAAGCCCAGATAAGCCTGACCTCACCCTGCCAATTCCATTTACTACTGATCCTAAGAAGAGTCTTTTCATCCTTAAGGAAGGAAGCAAATGCCAAATGAAATTCACCTTCACTGTCTCCAACAACATCGTTTCTGGTCTCAAATACACAAACGTTGTTTGGAAAACTGGCGTTAGAGTGGACAGCAGAAAAAAGATGTTGGGAACTTTTAGTCCTCAGCAGGAACCATATACATTTGAATTGGAAGAAGAAACTATCCCTTCTGGCATGTTCGTCAGGGGAACCTATGCAGCAAGAACCAAGTTTGTAGACGACGATCGAAAATGCTACTTGGATGTCAATTACTACTTTGAAATTCAGAAGAACAGACCAACACCTTAA

>Glyma18g00760.1   sequence type=predicted peptide   gene model=Glyma18g00760   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSAAVSSTTPHLEEELKNKATNNKKKNNVGGESDQPPYNDGANSDVAEETEPEEDDDSKLESNKDLDLGPQFTLKEQLEKDKDDESLRKWKEQLLGSVDMSVVGSECKDPEVKILSLIITSPDKPDLTLPIPFTTDPKKSLFILKEGSKCQMKFTFTVSNNIVSGLKYTNVVWKTGVRVDSRKKMLGTFSPQQEPYTFELEEETIPSGMFVRGTYAARTKFVDDDRKCYLDVNYYFEIQKNRPTP*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo