Report for Sequence Feature Glyma18g00690
Feature Type: gene_model
Chromosome: Gm18
Start: 304814
stop: 305594
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g00690
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G31980 AT
Annotation by Michelle Graham. TAIR10: PHYTOCYSTATIN 2 | chr2:13609246-13609770 REVERSE LENGTH=147
SoyBase E_val: 7.00E-29 ISS
GO:0009062 GO-bp
Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process
SoyBase N/A ISS
GO:0010162 GO-bp
Annotation by Michelle Graham. GO Biological Process: seed dormancy process
SoyBase N/A ISS
GO:0005576 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: extracellular region
SoyBase N/A ISS
GO:0004869 GO-mf
Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase inhibitor activity
SoyBase N/A ISS
PTHR11413 Panther
CYSTATIN FAMILY MEMBER
JGI ISS
PTHR11413:SF13 Panther
CYSTATIN C
JGI ISS
PF00031 PFAM
Cystatin domain
JGI ISS
UniRef100_I1MYC1 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYC1_SOYBN
SoyBase E_val: 1.00E-99 ISS
UniRef100_Q84XY6 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Cystatin n=1 Tax=Malus x domestica RepID=Q84XY6_MALDO
SoyBase E_val: 1.00E-35 ISS
Expression Patterns of Glyma18g00690
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g00690
Paralog Evidence Comments
Glyma11g36780 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g00690 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g003700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g00690
Coding sequences of Glyma18g00690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g00690.1 sequence type=CDS gene model=Glyma18g00690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCTGTGGCTTTGACGATTCTGGTGACCCTTCTCTCGGTTCTCTCTTCTGCATCGTGTGCACGAATGGTTGGGGGGAAGACGGAGATCCCTGAAGTGAGAAAAAACAGGCAAGTGCAAGAGCTTGGAAGGTTCGCGGTGGAGGAGTATAACCTTGGTTTAAAGCTGTTGAAGAACAACAACGTCGACAATGGGAGAGAACAGTTGAACTTTTCAGCGGTGGTGGAGGCGCAGCAACAAGTGGTGTCAGGGATGAAGTACTACTTGAAGATCTCTGCTACTCATAATGGTGTTCACGAAATGTTCAACTCTGTGGTGGTGGTCAAGCCATGGCTTCATTCCAAGCAGCTCCTCCATTTTGCGCCTGCATCATCATCCACCACCACCACCACCACCACCATGCATCCAGTAGTACGTAAAGATAATTGA
Predicted protein sequences of Glyma18g00690
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g00690.1 sequence type=predicted peptide gene model=Glyma18g00690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAVALTILVTLLSVLSSASCARMVGGKTEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYLKISATHNGVHEMFNSVVVVKPWLHSKQLLHFAPASSSTTTTTTTMHPVVRKDN*