Glyma18g00690 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma18g00690

Feature Type:	gene_model
Chromosome:	Gm18
Start:	304814
stop:	305594
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma18g00690

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G31980	AT	Annotation by Michelle Graham. TAIR10: PHYTOCYSTATIN 2 \| chr2:13609246-13609770 REVERSE LENGTH=147	SoyBase	E_val: 7.00E-29	ISS
GO:0009062	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid catabolic process	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0004869	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase inhibitor activity	SoyBase	N/A	ISS
PTHR11413	Panther	CYSTATIN FAMILY MEMBER	JGI		ISS
PTHR11413:SF13	Panther	CYSTATIN C	JGI		ISS
PF00031	PFAM	Cystatin domain	JGI		ISS
UniRef100_I1MYC1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MYC1_SOYBN	SoyBase	E_val: 1.00E-99	ISS
UniRef100_Q84XY6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cystatin n=1 Tax=Malus x domestica RepID=Q84XY6_MALDO	SoyBase	E_val: 1.00E-35	ISS

Expression Patterns of Glyma18g00690

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma18g00690

Paralog	Evidence	Comments
Glyma11g36780	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma18g00690 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.18g003700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma18g00690

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma18g00690

Limit To All Plant Sequences

>Glyma18g00690.1   sequence type=CDS   gene model=Glyma18g00690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGTGGCTTTGACGATTCTGGTGACCCTTCTCTCGGTTCTCTCTTCTGCATCGTGTGCACGAATGGTTGGGGGGAAGACGGAGATCCCTGAAGTGAGAAAAAACAGGCAAGTGCAAGAGCTTGGAAGGTTCGCGGTGGAGGAGTATAACCTTGGTTTAAAGCTGTTGAAGAACAACAACGTCGACAATGGGAGAGAACAGTTGAACTTTTCAGCGGTGGTGGAGGCGCAGCAACAAGTGGTGTCAGGGATGAAGTACTACTTGAAGATCTCTGCTACTCATAATGGTGTTCACGAAATGTTCAACTCTGTGGTGGTGGTCAAGCCATGGCTTCATTCCAAGCAGCTCCTCCATTTTGCGCCTGCATCATCATCCACCACCACCACCACCACCACCATGCATCCAGTAGTACGTAAAGATAATTGA

Predicted protein sequences of Glyma18g00690

Limit To All Plant Sequences

>Glyma18g00690.1   sequence type=predicted peptide   gene model=Glyma18g00690   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVALTILVTLLSVLSSASCARMVGGKTEIPEVRKNRQVQELGRFAVEEYNLGLKLLKNNNVDNGREQLNFSAVVEAQQQVVSGMKYYLKISATHNGVHEMFNSVVVVKPWLHSKQLLHFAPASSSTTTTTTTMHPVVRKDN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain