Report for Sequence Feature Glyma18g00450
Feature Type: gene_model
Chromosome: Gm18
Start: 152041
stop: 155497
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma18g00450
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT3G23910 AT
Annotation by Michelle Graham. TAIR10: BEST Arabidopsis thaliana protein match is: RNA-directed DNA polymerase (reverse transcriptase)-related family protein (TAIR:AT3G24255.2); Has 562 Blast hits to 532 proteins in 147 species: Archae - 28; Bacteria - 51; Metazoa - 157; Fungi - 82; Plants - 85; Viruses - 6; Other Eukaryotes - 153 (source: NCBI BLink). | chr3:8636594-8639344 REVERSE LENGTH=421
SoyBase E_val: 6.00E-64 ISS
GO:0006979 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to oxidative stress
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
UniRef100_I1LN23 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN23_SOYBN
SoyBase E_val: 1.00E-157 ISS
UniRef100_P92952 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: HAPp48,5 protein (Fragment) n=1 Tax=Arabidopsis thaliana RepID=P92952_ARATH
SoyBase E_val: 3.00E-61 ISS
Expression Patterns of Glyma18g00450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma18g00450
Paralog Evidence Comments
Glyma11g36540 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma18g00450 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.18g001700 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma18g00450
Coding sequences of Glyma18g00450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma18g00450.2 sequence type=CDS gene model=Glyma18g00450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGAAGTTGGTTCTAAAGTCTCTACAGAATCTTCAGTTTACAGTCAAATGGTTTGAAGTTGTAGAGCAGATTGAGTATGCATTCATGGAGCTAAAAGTGCTTGCATTCGGTGAGAATTGCATTAGGTTGTCGTTGCAGACTTATATGCCAACATTTGTGGGCATTTCCTACCTACCGAGAGTTGAAGCTACCGTTGATACAGCTGAACTGAATCATGAGTTATTAATTGAAGTTTTTGAGGGAACTATGAGGTCAAAGAATGTTCAGGTTTTTCCAAATGATATATATGTGAACGACATTGTTGATACTGCAAAGTTTGTCAGCAAGTCTTCATTGCAGTGGTTTATACAGAAAGTGCAAGATAGAATTATACTAAGCACACTTAGGCATCTTGTAGTAAAGGATGCTAATAAATCAAGATATTCGCTTGAATACTTGGACAAAGATAAGACTATTGTGGTTCATATGGCTGGAGGAATCGATGCGTACATAAAATTGTCACTTGGTTGGCCTATATTTGTTTCTCCATTGAAACTGATATGTATAAAGGGATCAGATGATTTGAAGAGAACTTCTCTAAGTTTTCGTTGCAAAGTTGAGAAGTTGGCCAATTCTTTAGATACCCATATTCGGCAGAATATATCAAGTTTCGTCGATGCAGTTGAAGAAGTACTTATGGAACAATTGCAGCTTGATCTTCGGGTCGGTGATAATTCAGGTTAA
Predicted protein sequences of Glyma18g00450
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma18g00450.2 sequence type=predicted peptide gene model=Glyma18g00450 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MKLVLKSLQNLQFTVKWFEVVEQIEYAFMELKVLAFGENCIRLSLQTYMPTFVGISYLPRVEATVDTAELNHELLIEVFEGTMRSKNVQVFPNDIYVNDIVDTAKFVSKSSLQWFIQKVQDRIILSTLRHLVVKDANKSRYSLEYLDKDKTIVVHMAGGIDAYIKLSLGWPIFVSPLKLICIKGSDDLKRTSLSFRCKVEKLANSLDTHIRQNISSFVDAVEEVLMEQLQLDLRVGDNSG*