SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g37750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g37750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g37750

Feature Type:gene_model
Chromosome:Gm17
Start:41478862
stop:41480054
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g37750
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G18420AT Annotation by Michelle Graham. TAIR10: Gibberellin-regulated family protein | chr2:7993861-7994334 FORWARD LENGTH=94 SoyBaseE_val: 1.00E-26ISS
GO:0009739GO-bp Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF02704PFAM Gibberellin regulated protein JGI ISS
UniRef100_C6SYA1UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6SYA1_SOYBN SoyBaseE_val: 1.00E-71ISS
UniRef100_C9E1T3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gast1-like protein n=1 Tax=Jatropha curcas RepID=C9E1T3_9ROSI SoyBaseE_val: 3.00E-31ISS

Expression Patterns of Glyma17g37750
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g37750 not represented in the dataset
Glyma17g37750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g37750 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g258100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g37750
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g37750
>Glyma17g37750.1   sequence type=CDS   gene model=Glyma17g37750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCATCTTTAAGGCGCTCCTTGCTTCAATCCTCATTTCTCTGGTCATTGTGAATCTGGTGGAATCAGATACAATGTATCAGGTAATCAAGAACACGGTAGAGGGATCAAGTCCTAGCCCTTCCCCGCCAACGATCGATTGTGATGTTGAATGTAATCGGAGGTGTCAATTATCATCAAGACCAAATTTGTGCAAGAGAGCATGTGGGACGTGCTGTCAGCGGTGCAATTGTGTGCCTTCGGGTACCTATGGTCATTATGAAGAGTGTTCATGCTATGCAAATATGACCACCCACGGTGGAAAACATAAATGTCCATAA
Predicted protein sequences of Glyma17g37750
>Glyma17g37750.1   sequence type=predicted peptide   gene model=Glyma17g37750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAIFKALLASILISLVIVNLVESDTMYQVIKNTVEGSSPSPSPPTIDCDVECNRRCQLSSRPNLCKRACGTCCQRCNCVPSGTYGHYEECSCYANMTTHGGKHKCP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo