SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g37681

Feature Type:gene_model
Chromosome:Gm17
Start:41420006
stop:41422727
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g37681
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G75690AT Annotation by Michelle Graham. TAIR10: DnaJ/Hsp40 cysteine-rich domain superfamily protein | chr1:28422273-28423170 REVERSE LENGTH=154 SoyBaseE_val: 6.00E-79ISS
GO:0006098GO-bp Annotation by Michelle Graham. GO Biological Process: pentose-phosphate shunt SoyBaseN/AISS
GO:0006364GO-bp Annotation by Michelle Graham. GO Biological Process: rRNA processing SoyBaseN/AISS
GO:0009657GO-bp Annotation by Michelle Graham. GO Biological Process: plastid organization SoyBaseN/AISS
GO:0010206GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II repair SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0035304GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0003756GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide isomerase activity SoyBaseN/AISS
GO:0031072GO-mf Annotation by Michelle Graham. GO Molecular Function: heat shock protein binding SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
UniRef100_Q8GSJ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Protein disulfide-isomerase LQY1 n=1 Tax=Arabidopsis thaliana RepID=LQY1_ARATH SoyBaseE_val: 3.00E-76ISS
UniRef100_UPI000233EACBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EACB related cluster n=1 Tax=unknown RepID=UPI000233EACB SoyBaseE_val: 2.00E-108ISS

Expression Patterns of Glyma17g37681
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g37681 not represented in the dataset
Glyma17g37681 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g37681
ParalogEvidenceComments
Glyma14g40490 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g37681 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g257400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g37681
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g37681
>Glyma17g37681.1   sequence type=CDS   gene model=Glyma17g37681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGTACTGTCTCCTTCTCTTTCTCGGCCTAAGTTGCAATCTTCCTTTCTTTGTTGCCCTCTCAAATATTCTAAGCCTACAAATAGAAATATTCAACCAAAACCCACTTCTTATCCACGCATTAGAGCTTTGGACCTTGATCAAAACACGGTAGTGGCTATAAGTGTAGGTGTTGTTAGTGTGGCTGTTGGGATTGGCATTCCAGTGTTCTATGAAACCCAAATTGATAATGCTGCTAAGCGAGAAAACACACAGCCCTGTTTCCCATGCAATGGATCTGGCGCTCAGAAATGCAGATTTTGCTTGGGAAATGGCAATGTGACAGTTGAACTTGGTGGAGGTGAGGAGGAGGTGTCTCGATGCATAAATTGTGACGGTGTTGGTTCATTGACATGCACAACTTGTCAAGGATCTGGAATTCAACCTCGTTACCTTGACCGCAGAGAATTCAAAGATGATGACTGA
Predicted protein sequences of Glyma17g37681
>Glyma17g37681.1   sequence type=predicted peptide   gene model=Glyma17g37681   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTVLSPSLSRPKLQSSFLCCPLKYSKPTNRNIQPKPTSYPRIRALDLDQNTVVAISVGVVSVAVGIGIPVFYETQIDNAAKRENTQPCFPCNGSGAQKCRFCLGNGNVTVELGGGEEEVSRCINCDGVGSLTCTTCQGSGIQPRYLDRREFKDDD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo