Glyma17g37391 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g37391): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g37391): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g37391

Feature Type:	gene_model
Chromosome:	Gm17
Start:	41137749
stop:	41139809
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g37391

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G45330	AT	Annotation by Michelle Graham. TAIR10: RNA 2'-phosphotransferase, Tpt1 / KptA family \| chr2:18686340-18687874 FORWARD LENGTH=289	SoyBase	E_val: 4.00E-65	ISS
GO:0006388	GO-bp	Annotation by Michelle Graham. GO Biological Process: tRNA splicing, via endonucleolytic cleavage and ligation	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0000215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: tRNA 2'-phosphotransferase activity	SoyBase	N/A	ISS
GO:0016772	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups	SoyBase	N/A	ISS
PTHR12684	Panther	PUTATIVE PHOSPHOTRANSFERASE	JGI		ISS
PF01885	PFAM	RNA 2'-phosphotransferase, Tpt1 / KptA family	JGI		ISS
UniRef100_G7JDD6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: tRNA 2'-phosphotransferase n=1 Tax=Medicago truncatula RepID=G7JDD6_MEDTR	SoyBase	E_val: 4.00E-69	ISS
UniRef100_UPI000233E93B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E93B related cluster n=1 Tax=unknown RepID=UPI000233E93B	SoyBase	E_val: 7.00E-85	ISS

Expression Patterns of Glyma17g37391

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g37391 not represented in the dataset	Glyma17g37391 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g37391 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g254800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g37391

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g37391

Limit To All Plant Sequences

>Glyma17g37391.1   sequence type=CDS   gene model=Glyma17g37391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTGGAACAGTCTGTTCTATTTGGCCGTTGAAACTGAAAGCTTGTTGAAACCAATCCTTTCAGCCGAAGAATTTCCAGTTTGTGTGCATGGAACCTACAGAAAGAACCTGGAATCAATTCTAGGATCTGGTCTGAAGCGCATGAAGAGATTGCATGTTCATTTCTCTTGTGGTTTACCAACAGATGGAGAAGTAATTAGTGGTATGAGGCAGGATGTCAATGTTCTGATCTTTCTAGACGTTAGAAAAGCATTAGAAGAATGTATGAAGCTTTACATTTCTGACAACAAGGTGATCTTGACAGAAGGTTTTGATGGTGTTGTTCCTCCCAAGTATTTTGAAAAGATAGAATCATGGCCGGGCAAACAGCCCATTCCTTTTTAA

Predicted protein sequences of Glyma17g37391

Limit To All Plant Sequences

>Glyma17g37391.1   sequence type=predicted peptide   gene model=Glyma17g37391   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEWNSLFYLAVETESLLKPILSAEEFPVCVHGTYRKNLESILGSGLKRMKRLHVHFSCGLPTDGEVISGMRQDVNVLIFLDVRKALEECMKLYISDNKVILTEGFDGVVPPKYFEKIESWPGKQPIPF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain