Report for Sequence Feature Glyma17g36921
Feature Type: gene_model
Chromosome: Gm17
Start: 40841787
stop: 40843580
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g36921
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_Q0PJF4 UniRef
Annotation by Michelle Graham. Best UniRef hit: MYB transcription factor MYB97 (Fragment) n=1 Tax=Glycine max RepID=Q0PJF4_SOYBN
SoyBase E_val: 1.00E-26 ISS
UniRef100_Q0PJF4 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: MYB transcription factor MYB97 (Fragment) n=1 Tax=Glycine max RepID=Q0PJF4_SOYBN
SoyBase E_val: 1.00E-26 ISS
Expression Patterns of Glyma17g36921
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma17g36921
Paralog Evidence Comments
Glyma14g08101 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g36921 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma17g36921
Coding sequences of Glyma17g36921
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g36921.1 sequence type=CDS gene model=Glyma17g36921 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCTCGTTGATGATTTGAAGCAAATTGAAGAAGGTCACGTGCCCTTGCCTAATTACAGAAATGTTGCTGCAACAGGAGGAAGCAGCATCAGAGGCTACAGTTACATGGAGGAAGAACAAAGGAAGAAGGCTCTAAGCCTCCGCTGA
Predicted protein sequences of Glyma17g36921
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g36921.1 sequence type=predicted peptide gene model=Glyma17g36921 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MLVDDLKQIEEGHVPLPNYRNVAATGGSSIRGYSYMEEEQRKKALSLR*