SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g36661): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g36661): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g36661

Feature Type:gene_model
Chromosome:Gm17
Start:40613189
stop:40614297
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g36661
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11360AT Annotation by Michelle Graham. TAIR10: Adenine nucleotide alpha hydrolases-like superfamily protein | chr1:3822171-3822899 REVERSE LENGTH=242 SoyBaseE_val: 2.00E-31ISS
GO:0002238GO-bp Annotation by Michelle Graham. GO Biological Process: response to molecule of fungal origin SoyBaseN/AISS
GO:0016925GO-bp Annotation by Michelle Graham. GO Biological Process: protein sumoylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
PF00582PFAM Universal stress protein family JGI ISS
UniRef100_C0Z2J1UniRef Annotation by Michelle Graham. Most informative UniRef hit: AT1G11360 protein n=2 Tax=Arabidopsis thaliana RepID=C0Z2J1_ARATH SoyBaseE_val: 1.00E-28ISS
UniRef100_UPI000233E7CDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E7CD related cluster n=1 Tax=unknown RepID=UPI000233E7CD SoyBaseE_val: 1.00E-78ISS

Expression Patterns of Glyma17g36661
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g36661 not represented in the dataset
Glyma17g36661 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g36661 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g248100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g36661
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g36661
>Glyma17g36661.1   sequence type=CDS   gene model=Glyma17g36661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGACCCACCAGAACCCTCCCACACTGGATTCCGACCCGCAGCTCCCGCAGATCAAAATCCACCACCCCTCCTCCCCGCGCCATCACCACCCCTCCTCCGCCGCCACCCCCACCCCCACCGCCGGCGCACGCCGCAAAATCGGCGTGGCCGTCGACCTCTCCGACGAGAGCGCCTACGCGGTCCGCTGGGCCGTGCAGCACTACATCCGCCCCGGGGACGCCATGATCCTGCTCCACCGCCTCCACGTCAGCCCTACCAACGTCCTCTTCGGCGCCGACTGGGGCTCGATCGACCTCTCCATCAACACTGACCCCAACTCCGACGAAGACGCCGTCAGCGCCGTCAACAGTAACGACCACAGTCACTCTTACATAAAATTAAAAGGGTTATGCCAGAGCCTGGGCAATTGCCCAGGGTAG
Predicted protein sequences of Glyma17g36661
>Glyma17g36661.1   sequence type=predicted peptide   gene model=Glyma17g36661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQTHQNPPTLDSDPQLPQIKIHHPSSPRHHHPSSAATPTPTAGARRKIGVAVDLSDESAYAVRWAVQHYIRPGDAMILLHRLHVSPTNVLFGADWGSIDLSINTDPNSDEDAVSAVNSNDHSHSYIKLKGLCQSLGNCPG*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo