Glyma17g36290 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g36290

Feature Type:	gene_model
Chromosome:	Gm17
Start:	40248917
stop:	40251023
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g36290

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G26550	AT	Annotation by Michelle Graham. TAIR10: heme oxygenase 2 \| chr2:11291584-11293426 REVERSE LENGTH=299	SoyBase	E_val: 5.00E-28	ISS
GO:0006788	GO-bp	Annotation by Michelle Graham. GO Biological Process: heme oxidation	SoyBase	N/A	ISS
GO:0010024	GO-bp	Annotation by Michelle Graham. GO Biological Process: phytochromobilin biosynthetic process	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004392	GO-mf	Annotation by Michelle Graham. GO Molecular Function: heme oxygenase (decyclizing) activity	SoyBase	N/A	ISS
PTHR10720	Panther	HEME OXYGENASE	JGI		ISS
UniRef100_I1MXR1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MXR1_SOYBN	SoyBase	E_val: 5.00E-142	ISS
UniRef100_O48722	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Probable inactive heme oxygenase 2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=HMOX2_ARATH	SoyBase	E_val: 2.00E-25	ISS

Expression Patterns of Glyma17g36290

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g36290

Paralog	Evidence	Comments
Glyma14g08880	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g36290 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g36290

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g36290

Limit To All Plant Sequences

>Glyma17g36290.1   sequence type=CDS   gene model=Glyma17g36290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TCATATCAACAACATGTGCAACAAAGGTCAGGATTAAAAGAAAACTGGATTGGAAAGATCAGAAGGGCTTTTGAAGGATCTGAAATGGTTTTAGGAAGAAGGAAATGTGATTCCGACTCCCGGTTCTCCAGGGCTTACATATGTCAAATATTTGGAGGAACTTGTGGAGATAAGCGCACCCTTGTTTCTCTCCCATTTCTACAATATCTATTTTTCTCATATAGCTGCTGGTCAGGTCATTGGAAAGAAGTGGATAATTTAATAATCATTTGCTTGTATTTTCTCATTCAAACAGTTATATTGAATGGTAGCTCGGTATTGAATTGGACTCATAAAAATATGCTTATAGACTTCTACAAACTCATGCAACCTTGTAGAGTTGAATATGTTTCTGAAGAGCTCTTGGAAGGCAAGGAGTTGGAGTTTTACAAATGGGAAGGAGATGTACCTGAATTGTTGAAAGATGTTCATGATAAGCTCAACATGCTTTCAGAGCATTGGTCTCGAGATGACAAGAATAGATGTTTAAAAGAAACTACAAAGGCATTCCGTTATATGGGACAAATTGTTCGTCTAATTGTCTCATAA

Predicted protein sequences of Glyma17g36290

Limit To All Plant Sequences

>Glyma17g36290.1   sequence type=predicted peptide   gene model=Glyma17g36290   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
SYQQHVQQRSGLKENWIGKIRRAFEGSEMVLGRRKCDSDSRFSRAYICQIFGGTCGDKRTLVSLPFLQYLFFSYSCWSGHWKEVDNLIIICLYFLIQTVILNGSSVLNWTHKNMLIDFYKLMQPCRVEYVSEELLEGKELEFYKWEGDVPELLKDVHDKLNMLSEHWSRDDKNRCLKETTKAFRYMGQIVRLIVS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain