Glyma17g36080 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g36080

Feature Type:	gene_model
Chromosome:	Gm17
Start:	40085753
stop:	40088821
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g36080

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G42890	AT	Annotation by Michelle Graham. TAIR10: sterol carrier protein 2 \| chr5:17194458-17195910 REVERSE LENGTH=123	SoyBase	E_val: 2.00E-49	ISS
GO:0006635	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation	SoyBase	N/A	ISS
GO:0007031	GO-bp	Annotation by Michelle Graham. GO Biological Process: peroxisome organization	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009686	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0032365	GO-bp	Annotation by Michelle Graham. GO Biological Process: intracellular lipid transport	SoyBase	N/A	ISS
GO:0046487	GO-bp	Annotation by Michelle Graham. GO Biological Process: glyoxylate metabolic process	SoyBase	N/A	ISS
GO:0048608	GO-bp	Annotation by Michelle Graham. GO Biological Process: reproductive structure development	SoyBase	N/A	ISS
GO:0005777	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: peroxisome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0032934	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sterol binding	SoyBase	N/A	ISS
KOG4170	KOG	2-enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase/Peroxisomal 3-ketoacyl-CoA-thiolase, sterol-binding domain and related enzymes	JGI		ISS
PTHR10094	Panther	SCP-2 STEROL TRANSFER DOMAIN FAMILY MEMBER	JGI		ISS
PTHR10094:SF8	Panther	STEROL CARRIER PROTEIN 2 (SCP-2)	JGI		ISS
PF02036	PFAM	SCP-2 sterol transfer family	JGI		ISS
UniRef100_C6T0J9	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6T0J9_SOYBN	SoyBase	E_val: 6.00E-65	ISS
UniRef100_G7I3K1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Non-specific lipid-transfer protein n=1 Tax=Medicago truncatula RepID=G7I3K1_MEDTR	SoyBase	E_val: 9.00E-53	ISS

Expression Patterns of Glyma17g36080

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g36080

Paralog	Evidence	Comments
Glyma14g09100	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g36080 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g242300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g36080

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Transcripts of Glyma17g36080

Limit To All Plant Sequences

>Glyma17g36080.2   sequence type=transcript   gene model=Glyma17g36080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAAAGGAGAAGCCATATAAAACACATACTAGTCTGTTTTAAAACAGAGTATGGGTCTGATCTGATCCACATTGAGACGCGTGCGGCAGATGGGCCTGAACCCAATCTTATCCTATTCTCACAAGCATTAAATACATCACTCTTCTAATCAAACGCTTTCAATGCACAAAACTGTAACGTGACGAAACAGAGGGATTATAAAAAGAGAAGTTACTCGATAGTTCAAATCAGAAGATGGTTCCTGTCACACCAACTCAATAACAGATCAAACCAAACCCAAACTGTTAGGTTTCCTTTGTTTGGTGTGAAGCCATGGCTGATTCTTCTTCCAACCTGAAATCCGACGCGATAATGGAGCAGATGAAGCAACACCTCGCCACCGACGCTGGCAAACAAGTCACCAATAAAATTGGACTCGTTTATCAGTTTCACATTGCTCCTAAGAAACTTGGATTCGACGAGGTCGTCTACACCGTTGATCTCAAGAAAGGAGAGGTCACCAAAGGGTCATATGAAGGAGGAAAGCCTGATGCATCTTTTTCGTTTAAGGATGAGGACTTTGTTAAGGTTGCCTTAGGGAAGATGAATCCGCAGATTGCTTTCATGAGGTTCGACCTTTCAATGGACTTTTTTCTTCCTAAATTTCTTCTTTGTTTATGCGTTCATGTGCTGATGTGCTTGTATTTGATGTGGTGGTTAATGGATGTAGGGGTGCGATGAAGATTAAGGGAAGTTTGAGTGCTGCTCAGAAATTTACTCCGGATATCTTCCCAAAGCCTTCTAAGCTGTGAGCTGAGATTTCTGCAACTACCTGCACAAGGTTGCTAGAATTATCGTTTGGCTGCAGTCAAACAAAATAGATAGCAATCATAGTAGCATCAAAAGCTGAGGATTATAATTATATCTTTAGTTAATGCATGGATCATCATTCCTAAGGTTGTTGGTGGTTCATGATTTTAATATATCTCTGAACACTGAAGGATATTTTTAGATACTCTTCTGCAAATCTGTCATAGGTTTTTATTCTACTGTGATTGGATGTTTCAAGTTTGAAAATAGTTAGTTCATCGTGCATTATTTAGAGCTACTTTTCCATTCTTTTGTCATAAATTCTCACCGAGCCAATAATTGTGGGATGGATGTTAGGAATCGTGTTTTCTGACTAAATGCATTGTCAATATACAT

Coding sequences of Glyma17g36080

Limit To All Plant Sequences

>Glyma17g36080.1   sequence type=CDS   gene model=Glyma17g36080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATTCTTCTTCCAACCTGAAATCCGACGCGATAATGGAGCAGATGAAGCAACACCTCGCCACCGACGCTGGCAAACAAGTCACCAATAAAATTGGACTCGTTTATCAGTTTCACATTGCTCCTAAGAAACTTGGATTCGACGAGGTCGTCTACACCGTTGATCTCAAGAAAGGAGAGGTCACCAAAGGGTCATATGAAGGAGGAAAGCCTGATGCATCTTTTTCGTTTAAGGATGAGGACTTTGTTAAGGTTGCCTTAGGGAAGATGAATCCGCAGATTGCTTTCATGAGGGGTGCGATGAAGATTAAGGGAAGTTTGAGTGCTGCTCAGAAATTTACTCCGGATATCTTCCCAAAGCCTTCTAAGCTGTGA

>Glyma17g36080.2   sequence type=CDS   gene model=Glyma17g36080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGATTCTTCTTCCAACCTGAAATCCGACGCGATAATGGAGCAGATGAAGCAACACCTCGCCACCGACGCTGGCAAACAAGTCACCAATAAAATTGGACTCGTTTATCAGTTTCACATTGCTCCTAAGAAACTTGGATTCGACGAGGTCGTCTACACCGTTGATCTCAAGAAAGGAGAGGTCACCAAAGGGTCATATGAAGGAGGAAAGCCTGATGCATCTTTTTCGTTTAAGGATGAGGACTTTGTTAAGGTTGCCTTAGGGAAGATGAATCCGCAGATTGCTTTCATGAGGTTCGACCTTTCAATGGACTTTTTTCTTCCTAAATTTCTTCTTTGTTTATGCGTTCATGTGCTGATGTGCTTGTATTTGATGTGGTGGTTAATGGATGTAGGGGTGCGATGA

Predicted protein sequences of Glyma17g36080

Limit To All Plant Sequences

>Glyma17g36080.1   sequence type=predicted peptide   gene model=Glyma17g36080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADSSSNLKSDAIMEQMKQHLATDAGKQVTNKIGLVYQFHIAPKKLGFDEVVYTVDLKKGEVTKGSYEGGKPDASFSFKDEDFVKVALGKMNPQIAFMRGAMKIKGSLSAAQKFTPDIFPKPSKL*

>Glyma17g36080.2   sequence type=predicted peptide   gene model=Glyma17g36080   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADSSSNLKSDAIMEQMKQHLATDAGKQVTNKIGLVYQFHIAPKKLGFDEVVYTVDLKKGEVTKGSYEGGKPDASFSFKDEDFVKVALGKMNPQIAFMRFDLSMDFFLPKFLLCLCVHVLMCLYLMWWLMDVGVR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain