SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g36014): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g36014): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g36014

Feature Type:gene_model
Chromosome:Gm17
Start:40009310
stop:40011650
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g36014
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G45231AT Annotation by Michelle Graham. TAIR10: S-adenosyl-L-methionine-dependent methyltransferases superfamily protein | chr1:17148019-17151194 REVERSE LENGTH=538 SoyBaseE_val: 2.00E-73ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0009452GO-bp Annotation by Michelle Graham. GO Biological Process: 7-methylguanosine RNA capping SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0008168GO-mf Annotation by Michelle Graham. GO Molecular Function: methyltransferase activity SoyBaseN/AISS
KOG2730 KOG Methylase JGI ISS
PTHR14741Panther S-ADENOSYLMETHIONINE-DEPENDENT METHYLTRANSFERASE RELATED JGI ISS
PTHR14741:SF23Panther OS03G0396900 PROTEIN JGI ISS
PF09445PFAM RNA cap guanine-N2 methyltransferase JGI ISS
UniRef100_G7I3J0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Trimethylguanosine synthase n=1 Tax=Medicago truncatula RepID=G7I3J0_MEDTR SoyBaseE_val: 1.00E-80ISS
UniRef100_I1MXN5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MXN5_SOYBN SoyBaseE_val: 2.00E-101ISS

Expression Patterns of Glyma17g36014
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g36014 not represented in the dataset
Glyma17g36014 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g36014 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g36014
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g36014
>Glyma17g36014.1   sequence type=CDS   gene model=Glyma17g36014   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTGAAGTGTATTCTGTTGCAGTTGGAAAATATTGGTGTCAGAGGCATAGTTTGTTCTCTAGATTTGATGATGGTGTAAAAATGGATGAGGAAGGATGGTTTTCTGTCACTCCAGAGGTTCTTGCTCGGCATCGAGCAATACGTTGTGCTAGTGGCGTGATAATTGACGGTTTCACTGGTGTTGGCGGGAATGCTATCCAATTTGCACGACACAGTCTTGGTTGGCCTCCTTTGTGGCTGCTGGCTGATACAGTTTTCTTATCTCCTCCATGGGGGGGACCTGATTATGTCAAGGCTACTACTTTTGACTTGAAGACAATGCTTAGACCACATGATGGATATACACTGTTTAATGTTGCAAAGGAGATTGCTTCCGGAGTTATGTTCCTTCCAAGAAATATCAATTTCAACCAATTGGCAGAGTTATCTCTGTCATCCTGTCCATCATGGTCACTAGAGGTGGAGAAAGTTTATTTAAATAATAAATTGAAGGCGATCACTGCTTATTTCAGTGATACAGCAGTTGGGAATGTGCGAAGTTAA
Predicted protein sequences of Glyma17g36014
>Glyma17g36014.1   sequence type=predicted peptide   gene model=Glyma17g36014   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPEVYSVAVGKYWCQRHSLFSRFDDGVKMDEEGWFSVTPEVLARHRAIRCASGVIIDGFTGVGGNAIQFARHSLGWPPLWLLADTVFLSPPWGGPDYVKATTFDLKTMLRPHDGYTLFNVAKEIASGVMFLPRNINFNQLAELSLSSCPSWSLEVEKVYLNNKLKAITAYFSDTAVGNVRS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo