SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g35951

Feature Type:gene_model
Chromosome:Gm17
Start:39917384
stop:39921012
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g35951
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G36930AT Annotation by Michelle Graham. TAIR10: basic helix-loop-helix (bHLH) DNA-binding superfamily protein | chr4:17414167-17415945 FORWARD LENGTH=373 SoyBaseE_val: 3.00E-38ISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009908GO-bp Annotation by Michelle Graham. GO Biological Process: flower development SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010154GO-bp Annotation by Michelle Graham. GO Biological Process: fruit development SoyBaseN/AISS
GO:0010187GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of seed germination SoyBaseN/AISS
GO:0048440GO-bp Annotation by Michelle Graham. GO Biological Process: carpel development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0003700GO-mf Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR10014Panther BASIC HELIX-LOOP-HELIX/LEUCINE ZIPPER TRANSCRIPTION FACTOR JGI ISS
PF00010PFAM Helix-loop-helix DNA-binding domain JGI ISS
UniRef100_G7I3I4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor SPATULA n=1 Tax=Medicago truncatula RepID=G7I3I4_MEDTR SoyBaseE_val: 1.00E-75ISS
UniRef100_I1MXN0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MXN0_SOYBN SoyBaseE_val: 6.00E-106ISS

Expression Patterns of Glyma17g35951
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g35951 not represented in the dataset
Glyma17g35951 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g35951
ParalogEvidenceComments
Glyma14g09231 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g35951 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g241000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g35951
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g35951
>Glyma17g35951.1   sequence type=CDS   gene model=Glyma17g35951   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGGTGACGTAGGAAGAGCCTTGCCTCCTCCTGATTCAGAAGAATTCTCAACCTTGTTCAGCCAACTCCTCCACAATTCTCCCCCACTAGGAATGGACCCCAATCATTCACCTCCTGATTTCACCCCACACAACAACACCATCGACATCAACATCAACAACAACATCATCAACAACAACAACAACAACAACCCTGTTCCTTCCTCTCCCTCAAATTTCAATTTCTCTGACCCCCATCATTACATCCCTGCCTCTGATGCCACCACCTTTAAACAACACACCCCTGATTTCACTTCTTTTTCTGTTGAGAAGAGTGTGGAGGCATCGAAACCTGTCCCACCACCACGTTCTTCTTCGTCAAAGAGGAGTAGAGCTGCAGAGTTCCATAATTTGTCTGAAAAGAGAAGGAGGAGTAGGATTAACGAGAAAATGAAAGCCTTGCAGAATTTAATTCCAAATTCTAACAAGACAGACAAAGCTTCAATGCTAGATGAGGCCATAGAATATTTAAAGCAGCTTCAGCTTCAAGTGCAAATGTTAATGATGAGAAATGGTTTGAGCTTGCATCCAATGTCTTTGCCAGGAGGACTAAGACCTATGATAATGTCTCAGACTGGATTGAACCTTGATGGGAGTAATGGATTTCATAATTCTACCAGTGCAATTGCCTCATCTTCAAATGATGAAAGCTTAGTGCGGCATGCTTTTAGTTTTCCAAAGCAATGCAGCATCTCAAATCAGTCTATTGGTGTACCCTCAGTGACAAACATAGCAACTTCGGATACCTCATCCACTTTTCATCCCTCTATTAAGGATGCACTCTACGGCAACATGCCACAACTGTTTATGGATACAACAACGATGGGAAAACCCTCTCCAGATGTGTCTTAA
Predicted protein sequences of Glyma17g35951
>Glyma17g35951.1   sequence type=predicted peptide   gene model=Glyma17g35951   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAGDVGRALPPPDSEEFSTLFSQLLHNSPPLGMDPNHSPPDFTPHNNTIDININNNIINNNNNNNPVPSSPSNFNFSDPHHYIPASDATTFKQHTPDFTSFSVEKSVEASKPVPPPRSSSSKRSRAAEFHNLSEKRRRSRINEKMKALQNLIPNSNKTDKASMLDEAIEYLKQLQLQVQMLMMRNGLSLHPMSLPGGLRPMIMSQTGLNLDGSNGFHNSTSAIASSSNDESLVRHAFSFPKQCSISNQSIGVPSVTNIATSDTSSTFHPSIKDALYGNMPQLFMDTTTMGKPSPDVS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo