Glyma17g35860 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g35860

Feature Type:	gene_model
Chromosome:	Gm17
Start:	39839677
stop:	39840892
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g35860

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G46768	AT	Annotation by Michelle Graham. TAIR10: related to AP2 1 \| chr1:17266046-17266507 REVERSE LENGTH=153	SoyBase	E_val: 1.00E-48	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009414	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to water deprivation	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_I1MXM4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MXM4_SOYBN	SoyBase	E_val: 5.00E-128	ISS
UniRef100_Q7Y0Y9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Dehydration responsive element binding protein n=1 Tax=Glycine max RepID=Q7Y0Y9_SOYBN	SoyBase	E_val: 1.00E-110	ISS

Expression Patterns of Glyma17g35860

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g35860

Paralog	Evidence	Comments
Glyma14g09320	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g35860 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g240100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g35860

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g35860

Limit To All Plant Sequences

>Glyma17g35860.1   sequence type=CDS   gene model=Glyma17g35860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAAAGAGATCACCGTTGTTCCAACAATTCAACGATGATCACAACAACAAAGAAAAAAACGAGCAGAAGAAGTCCCACATCGGATAAGCTGAAGAATCAACACCCCTGTGAGAAGCAGGCGATGAAACCGTACAGAGGAATAAGGATGCGAAAGTGGGGGAAGTGGGTGGCGGAGATCAGAGAACCCAACAAGAGGTCGAGGATTTGGTTGGGTTCGTACACGACACCCATGGCCGCCGCACGCGCCTACGACACAGCCGTTTTCTACCTCCGAGGTCCCACCGCACGCCTTAACTTCCCCGAACTCTTGTTCCAGGACGACCAGGAGGAGGGCAATGATTCGGTGCAGCACGGTGCAGCAGCAGGGAACATGTCCGCTGATTCCATTCGCCGAAAAGCCACGCAAGTCGGCGCCAGAGTCGACGCTCTCCAAACCGCGCTTCACCACCACGCGTCAAGTACCAACTCTCTCAAACCCGACTTGAACGAGTTTCCAAAACTCGAATCCCTTCAAGATTGA

Predicted protein sequences of Glyma17g35860

Limit To All Plant Sequences

>Glyma17g35860.1   sequence type=predicted peptide   gene model=Glyma17g35860   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEERDHRCSNNSTMITTTKKKTSRRSPTSDKLKNQHPCEKQAMKPYRGIRMRKWGKWVAEIREPNKRSRIWLGSYTTPMAAARAYDTAVFYLRGPTARLNFPELLFQDDQEEGNDSVQHGAAAGNMSADSIRRKATQVGARVDALQTALHHHASSTNSLKPDLNEFPKLESLQD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain