Glyma17g35610 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g35610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g35610): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g35610

Feature Type:	gene_model
Chromosome:	Gm17
Start:	39590487
stop:	39592081
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g35610

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G24210	AT	Annotation by Michelle Graham. TAIR10: F-box family protein \| chr4:12563658-12564113 FORWARD LENGTH=151	SoyBase	E_val: 2.00E-56	ISS
GO:0009723	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to ethylene stimulus	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0009863	GO-bp	Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009939	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0010325	GO-bp	Annotation by Michelle Graham. GO Biological Process: raffinose family oligosaccharide biosynthetic process	SoyBase	N/A	ISS
GO:0042538	GO-bp	Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response	SoyBase	N/A	ISS
GO:0048444	GO-bp	Annotation by Michelle Graham. GO Biological Process: floral organ morphogenesis	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0019005	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: SCF ubiquitin ligase complex	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF00646	PFAM	F-box domain	JGI		ISS
UniRef100_B9R752	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: F-box protein GID2, putative n=1 Tax=Ricinus communis RepID=B9R752_RICCO	SoyBase	E_val: 1.00E-63	ISS
UniRef100_I1MXK1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MXK1_SOYBN	SoyBase	E_val: 6.00E-126	ISS

Expression Patterns of Glyma17g35610

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g35610 not represented in the dataset	Glyma17g35610 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g35610

Paralog	Evidence	Comments
Glyma14g09560	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g35610 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g237800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g35610

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g35610

Limit To All Plant Sequences

>Glyma17g35610.1   sequence type=CDS   gene model=Glyma17g35610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCGCGCTTTCTCCGTCGACACCGCGGAGGATAACAAAAACAACAGGAACACGAAAAAGACAAAGCTTGATTCGGAAGAGGAAGAGGAACACGGGACACGTGGCGGCAGCGTGTACTTAGACGACAACGTTTTGTTCGAGGTGCTGAAGCACGTGGACGCGCGGTCGTTGGCGATGGCGGGGTGCGTGAGCAAGCAGTGGCAGAAGGCGGCGCGTGACGAGAGGCTATGGGAACTGATCTGCACCAAGCAGTGGGCAAACACAGGGTGCGGTGAGCAACAGCTACGATCCGTGGTCCTCGCCCTCGGAGGCTTCCGTCGTCTCCACGCGCTCTACCTCTGGCCTCTCTCCAAGCCCCACGCGCCTTCTTCTTCTTCTTCTTCTTCTTCGTGGCCTGCCATCCCGCACGTGCTTCGGTCCAAACCTCGTTGGGGCAAGGACGAGGTTCACCTCTCCCTCTCCCTACTCTCCATTCGTTACTACGAGAAGATGAATTTCCTTAACACCAAGAAAAACACATGA

Predicted protein sequences of Glyma17g35610

Limit To All Plant Sequences

>Glyma17g35610.1   sequence type=predicted peptide   gene model=Glyma17g35610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRAFSVDTAEDNKNNRNTKKTKLDSEEEEEHGTRGGSVYLDDNVLFEVLKHVDARSLAMAGCVSKQWQKAARDERLWELICTKQWANTGCGEQQLRSVVLALGGFRRLHALYLWPLSKPHAPSSSSSSSSWPAIPHVLRSKPRWGKDEVHLSLSLLSIRYYEKMNFLNTKKNT*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain