SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g35580

Feature Type:gene_model
Chromosome:Gm17
Start:39550895
stop:39552007
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g35580
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G43070AT Annotation by Michelle Graham. TAIR10: WPP domain protein 1 | chr5:17289259-17289726 REVERSE LENGTH=155 SoyBaseE_val: 8.00E-39ISS
GO:0006913GO-bp Annotation by Michelle Graham. GO Biological Process: nucleocytoplasmic transport SoyBaseN/AISS
GO:0048527GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005640GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear outer membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_Q9M7N4UniRef Annotation by Michelle Graham. Most informative UniRef hit: MFP1 attachment factor 1 n=1 Tax=Glycine max RepID=Q9M7N4_SOYBN SoyBaseE_val: 1.00E-87ISS
UniRef100_Q9M7N4UniRef Annotation by Michelle Graham. Best UniRef hit: MFP1 attachment factor 1 n=1 Tax=Glycine max RepID=Q9M7N4_SOYBN SoyBaseE_val: 1.00E-87ISS

Expression Patterns of Glyma17g35580
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g35580
ParalogEvidenceComments
Glyma14g09580 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g35580 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g237500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g35580
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g35580
>Glyma17g35580.1   sequence type=CDS   gene model=Glyma17g35580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCGACACGGAAACCACGCCCGAACAACCCTCCACTCCGCCGCAAACGGAGGCTCCGCCGCAGCCCGACCCCTCCGCCGCCGTCTCCTTCAGCATATGGCCCCCCACTCAGCGCACCCGCGACGCCGTCGTCAAACGCTTGATCGAGACCCTCTCCGCCCCCTCCGTCCTCTCCAAGCGCTACGGCACTCTCTCCTCCGACGAAGCCTCCGCCGCCGCCCGACAGATCGAGGACGAGGCCTTCTGCGCCGCCACCGCAGCCTCCGCTTCGGCCGCCGCCGACGGCATTGAGACCCTCCAGGTCTACTCCAAGGAGATCAGCAAGCGGATGCTCGACACCGTCAAGGCCAGAGCTCCGCCGAGTCCCGCCGCCGTAGAGGGCGTCGCCGCCGCCGTCTCCGACTAA
Predicted protein sequences of Glyma17g35580
>Glyma17g35580.1   sequence type=predicted peptide   gene model=Glyma17g35580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSDTETTPEQPSTPPQTEAPPQPDPSAAVSFSIWPPTQRTRDAVVKRLIETLSAPSVLSKRYGTLSSDEASAAARQIEDEAFCAATAASASAAADGIETLQVYSKEISKRMLDTVKARAPPSPAAVEGVAAAVSD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo