Glyma17g35530 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g35530

Feature Type:	gene_model
Chromosome:	Gm17
Start:	39520699
stop:	39522605
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g35530

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G59845	AT	Annotation by Michelle Graham. TAIR10: Gibberellin-regulated family protein \| chr5:24111443-24111808 FORWARD LENGTH=89	SoyBase	E_val: 7.00E-35	ISS
GO:0009739	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to gibberellin stimulus	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02704	PFAM	Gibberellin regulated protein	JGI		ISS
UniRef100_B9R733	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: GAST1 protein, putative n=1 Tax=Ricinus communis RepID=B9R733_RICCO	SoyBase	E_val: 2.00E-43	ISS
UniRef100_UPI000004A1AE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000004A1AE related cluster n=1 Tax=unknown RepID=UPI000004A1AE	SoyBase	E_val: 1.00E-54	ISS

Expression Patterns of Glyma17g35530

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g35530

Paralog	Evidence	Comments
Glyma14g09620	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g35530 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g237100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g35530

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g35530

Limit To All Plant Sequences

>Glyma17g35530.1   sequence type=CDS   gene model=Glyma17g35530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGTAGCATTTGCAGCTGTTCTACTTATATGCCTTGTCCTCAGCTCCTCCTTGTTCGAGGTGTCAATGGCTGGTTCTGCTTTCTGTTCCTCCAAGTGCTCGAAGAGGTGTTCTAGAGCTGGGATGAAGGACAGGTGCATGAAGTTCTGCGGGATTTGCTGCAGCAAGTGCAACTGTGTGCCATCTGGGACTTATGGGAACAAGCATGAGTGCCCTTGCTACAGAGACATGAAGAACTCCAAGGGCAAGGCCAAATGCCCTTGA

Predicted protein sequences of Glyma17g35530

Limit To All Plant Sequences

>Glyma17g35530.1   sequence type=predicted peptide   gene model=Glyma17g35530   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKVAFAAVLLICLVLSSSLFEVSMAGSAFCSSKCSKRCSRAGMKDRCMKFCGICCSKCNCVPSGTYGNKHECPCYRDMKNSKGKAKCP*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain