Glyma17g35165 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g35165

Feature Type:	gene_model
Chromosome:	Gm17
Start:	39174075
stop:	39174899
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g35165

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G37720	AT	Annotation by Michelle Graham. TAIR10: phytosulfokine 6 precursor \| chr4:17718961-17719318 REVERSE LENGTH=87	SoyBase	E_val: 1.00E-14	ISS
GO:0008283	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell proliferation	SoyBase	N/A	ISS
GO:0009887	GO-bp	Annotation by Michelle Graham. GO Biological Process: organ morphogenesis	SoyBase	N/A	ISS
GO:0030154	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell differentiation	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0031012	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular matrix	SoyBase	N/A	ISS
GO:0008083	GO-mf	Annotation by Michelle Graham. GO Molecular Function: growth factor activity	SoyBase	N/A	ISS
PF06404	PFAM	Phytosulfokine precursor protein (PSK)	JGI		ISS
UniRef100_B9SH34	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Phytosulfokines, putative n=1 Tax=Ricinus communis RepID=B9SH34_RICCO	SoyBase	E_val: 1.00E-14	ISS
UniRef100_UPI000233E50F	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E50F related cluster n=1 Tax=unknown RepID=UPI000233E50F	SoyBase	E_val: 9.00E-52	ISS

Expression Patterns of Glyma17g35165

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g35165 not represented in the dataset	Glyma17g35165 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g35165

Paralog	Evidence	Comments
Glyma14g09990	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g35165 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g233400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g35165

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g35165

Limit To All Plant Sequences

>Glyma17g35165.1   sequence type=CDS   gene model=Glyma17g35165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAAACTAGCCACTCTCTTGACTTTGGCTCTTCTACTGAGCTTCAATTTAATCTATGCCTCCCGTCCAAACCCTTCACTTATCAGTGTCTCTTCTTTGCATGGGGATGTTGCGGCTACAAAGGCAGAAGAGATAGATGGTGAGAGTTGTGAAGAAGGGACAGAGGAATGTTTGGCAAGAAGGACACTTGCTGCGCATCTCGATTATATCTACACTCAGAAGGATAAACTGGGTCAGCATTCTTAA

Predicted protein sequences of Glyma17g35165

Limit To All Plant Sequences

>Glyma17g35165.1   sequence type=predicted peptide   gene model=Glyma17g35165   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSKLATLLTLALLLSFNLIYASRPNPSLISVSSLHGDVAATKAEEIDGESCEEGTEECLARRTLAAHLDYIYTQKDKLGQHS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain