Report for Sequence Feature Glyma17g34940
Feature Type: gene_model
Chromosome: Gm17
Start: 38914352
stop: 38917452
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g34940
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT4G32930 AT
Annotation by Michelle Graham. TAIR10: unknown protein; CONTAINS InterPro DOMAIN/s: Protein of unknown function DUF866, eukaryotic (InterPro:IPR008584); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). | chr4:15898878-15900185 FORWARD LENGTH=167
SoyBase E_val: 2.00E-83 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005575 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cellular component
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
KOG1296
KOG
Uncharacterized conserved protein
JGI ISS
PTHR12857 Panther
UNCHARACTERIZED
JGI ISS
PF05907 PFAM
Eukaryotic protein of unknown function (DUF866)
JGI ISS
UniRef100_C6T594 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T594_SOYBN
SoyBase E_val: 2.00E-118 ISS
UniRef100_E4MX66 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-17-D09 n=1 Tax=Eutrema halophilum RepID=E4MX66_THEHA
SoyBase E_val: 4.00E-82 ISS
Expression Patterns of Glyma17g34940
Gene expression representations made with eFP at the University of Toronto. Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE Paralogs of Glyma17g34940
Paralog Evidence Comments
Glyma14g10571 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma17g34940 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g231200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g34940
Coding sequences of Glyma17g34940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g34940.1 sequence type=CDS gene model=Glyma17g34940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGAACTTCATGTTGATGATTACTGCAGAGCTTGAGAACCTCACGAATCTGCAACCCCAAGATGGCTGCGACGACCCCAACTTCTCCTACCTCTTCAAGTTGAAATGCGGGAGATGCGGAGAACTGAGCCAGAAAGAAACCTGCGTCGTCTTAAACGACACCGTTCCTCTCCCCGTTGGCAAGAGCACCACTCATCTCATTCAAAAGTGCAAATTTTGTGGCAGGGATGGCACTGTGACCATGATTGAAGGCAAAGGTAAACCACTCACCCAGGAAATCAGTGAATCAGGGAAGTACGCCCCATTGATGTTATTTGACTGTAGGGGCTATGAGCCAGTAGATTTTGTATTCGGTGATGGATGGAAAGTTGAATCACTGGAGGGAACTAAGTTTGAGAATGTTGACTTGTCAAGTGGAGAATATGCCGAGTATGATGAGAAGGGAGAGTGCCCAGTAATGATATCCAATCTTCGAGCTACTTTTGAAGTGACAAAGTAG
Predicted protein sequences of Glyma17g34940
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g34940.1 sequence type=predicted peptide gene model=Glyma17g34940 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVNFMLMITAELENLTNLQPQDGCDDPNFSYLFKLKCGRCGELSQKETCVVLNDTVPLPVGKSTTHLIQKCKFCGRDGTVTMIEGKGKPLTQEISESGKYAPLMLFDCRGYEPVDFVFGDGWKVESLEGTKFENVDLSSGEYAEYDEKGECPVMISNLRATFEVTK*
SoyBase
SoyBase transitions to NEW site on 10/1/2024
