SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g33400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g33400): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g33400

Feature Type:gene_model
Chromosome:Gm17
Start:37264302
stop:37271716
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G19780AT Annotation by Michelle Graham. TAIR10: tubulin alpha-5 | chr5:6687212-6688926 FORWARD LENGTH=450 SoyBaseE_val: 2.00E-55ISS
GO:0006184GO-bp Annotation by Michelle Graham. GO Biological Process: GTP catabolic process SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0007018GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based movement SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0051258GO-bp Annotation by Michelle Graham. GO Biological Process: protein polymerization SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005874GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0045298GO-cc Annotation by Michelle Graham. GO Cellular Compartment: tubulin complex SoyBaseN/AISS
GO:0003924GO-mf Annotation by Michelle Graham. GO Molecular Function: GTPase activity SoyBaseN/AISS
GO:0005198GO-mf Annotation by Michelle Graham. GO Molecular Function: structural molecule activity SoyBaseN/AISS
GO:0005200GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of cytoskeleton SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
PTHR11588Panther TUBULIN JGI ISS
PTHR11588:SF31Panther SUBFAMILY NOT NAMED JGI ISS
PF00091PFAM Tubulin/FtsZ family, GTPase domain JGI ISS
PF03953PFAM Tubulin C-terminal domain JGI ISS
UniRef100_C0SK31UniRef Annotation by Michelle Graham. Most informative UniRef hit: Alpha tubulin (Fragment) n=1 Tax=Paraphysomonas imperforata RepID=C0SK31_9STRA SoyBaseE_val: 2.00E-74ISS
UniRef100_UPI000233E1F4UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E1F4 related cluster n=1 Tax=unknown RepID=UPI000233E1F4 SoyBaseE_val: 3.00E-139ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g33400 not represented in the dataset

Glyma17g33400 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g218600 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g33400.1   sequence type=CDS   gene model=Glyma17g33400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGCCTTTTGACTCCACCTTCGATGTAGCCCACGACGCCTTCAACACCTTCAGCAAAACTGGATCTGGCAAGCACGTCCCCCGTGCTGTCTTTGTCGACCTAGAACCCACCGTCATCGGCGAGGTCCGCTATGGCACCTACCGCCAACTCTTCCACCTCGAACAACTCATCTCTGGCAGGGAAGACGCCGCTGACAACTTCGCCAGCGACCACTACACCATTGGCAAAGAGATCGTAGATCTGTGCTTGGATTGCATCCGCAAGCTCGTTGACAACTGCACCGGCCTACAAGGCTTCCTCGTCTTCAACGCCGTCGACGGTGGCAAGTACCCTAGGATCCACTTCATGCTTTCATCCTATGCTCCGGTTATCTCTGCTGCTATGTTCTACCATGAGCAGTTGTCGGTGCCGAAGATCACCAATGCCGTGTTCGAGCCCACCAGCATGATGGCCAAGTGTGATCCAAGGCAAGACAAGTACATGGCTTGCTGCTTGATGTACTGTGGTGATGTTGTCCCTAAGGATGTCAATACTGCTGTTGCCACCATCAAGACTAAGAGGACTGCCTAA

>Glyma17g33400.1   sequence type=predicted peptide   gene model=Glyma17g33400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMPFDSTFDVAHDAFNTFSKTGSGKHVPRAVFVDLEPTVIGEVRYGTYRQLFHLEQLISGREDAADNFASDHYTIGKEIVDLCLDCIRKLVDNCTGLQGFLVFNAVDGGKYPRIHFMLSSYAPVISAAMFYHEQLSVPKITNAVFEPTSMMAKCDPRQDKYMACCLMYCGDVVPKDVNTAVATIKTKRTA*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo