Glyma17g33075 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g33075

Feature Type:	gene_model
Chromosome:	Gm17
Start:	36682979
stop:	36684646
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g33075

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G25190	AT	Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein \| chr5:8707007-8707655 REVERSE LENGTH=181	SoyBase	E_val: 4.00E-75	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009873	GO-bp	Annotation by Michelle Graham. GO Biological Process: ethylene mediated signaling pathway	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
PF00847	PFAM	AP2 domain	JGI		ISS
UniRef100_B9HAT9	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: AP2/ERF domain-containing transcription factor n=1 Tax=Populus trichocarpa RepID=B9HAT9_POPTR	SoyBase	E_val: 3.00E-87	ISS
UniRef100_UPI000233E0BE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233E0BE related cluster n=1 Tax=unknown RepID=UPI000233E0BE	SoyBase	E_val: 1.00E-147	ISS

Expression Patterns of Glyma17g33075

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g33075 not represented in the dataset	Glyma17g33075 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g33075

Paralog	Evidence	Comments
Glyma14g13470	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g33075 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g216100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g33075

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g33075

Limit To All Plant Sequences

>Glyma17g33075.1   sequence type=CDS   gene model=Glyma17g33075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCAGACCACAACAGCGTTACCGAGGTGTCCGACAAAGGCATTGGGGCTCTTGGGTCTCCGAAATTCGCCACCCCATATTGAAGACTAGGATATGGCTTGGTACATTTGAAACAGCTGAGGATGCTGCTAGGGCCTATGATGAAGCAGCTAGGCTAATGTGTGGTGCAAGGGCAAGAACAAACTTCCCTTTCAATCCAAATGTGTCACACTCATCATCTTCTAGTTCAAAGCTTCTCTCAGCAACTTTGACTGCAAAACTTCACAGGTGCTACATGGCTTCTTTGCAAGTGACAAGACAAGCTTTGGCATCTGAGTCTCAGAGAACACCACCCTCAGTGCAAAATGCAACAACCTCCACAACCACACCAATTAGCAACAACTTCAGTGTGAAGAGTGAGCAAACTCATGCAGTGTTGCCACATAAGAGACCAGAGGAGGAGCAAGAGTCAGAGGCAAATAGGGGTGTGAAAAGGGTTAAGGCTGTGGAAAATGTTCCTCTGCAATTCAAGCCTCTTGAGGAAGATCACATAGAGCAAATGATTGAGGAGCTTCTTGATTATGGATCTATTGAACTCTGCTCTGTCATTTCACCCCAGGCCCTCTAA

Predicted protein sequences of Glyma17g33075

Limit To All Plant Sequences

>Glyma17g33075.1   sequence type=predicted peptide   gene model=Glyma17g33075   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARPQQRYRGVRQRHWGSWVSEIRHPILKTRIWLGTFETAEDAARAYDEAARLMCGARARTNFPFNPNVSHSSSSSSKLLSATLTAKLHRCYMASLQVTRQALASESQRTPPSVQNATTSTTTPISNNFSVKSEQTHAVLPHKRPEEEQESEANRGVKRVKAVENVPLQFKPLEEDHIEQMIEELLDYGSIELCSVISPQAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain