Glyma17g31305 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g31305): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g31305): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g31305

Feature Type:	gene_model
Chromosome:	Gm17
Start:	34440936
stop:	34441457
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g31305

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G78300	AT	Annotation by Michelle Graham. TAIR10: general regulatory factor 2 \| chr1:29461883-29463052 FORWARD LENGTH=259	SoyBase	E_val: 3.00E-49	ISS
GO:0009742	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid mediated signaling pathway	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005794	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0019904	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein domain specific binding	SoyBase	N/A	ISS
GO:0045309	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein phosphorylated amino acid binding	SoyBase	N/A	ISS
PTHR18860	Panther	14-3-3	JGI		ISS
PF00244	PFAM	14-3-3 protein	JGI		ISS
UniRef100_E9KNA4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: SGF14h n=1 Tax=Glycine max RepID=E9KNA4_SOYBN	SoyBase	E_val: 2.00E-56	ISS
UniRef100_UPI000233F4D3	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233F4D3 related cluster n=1 Tax=unknown RepID=UPI000233F4D3	SoyBase	E_val: 5.00E-85	ISS

Expression Patterns of Glyma17g31305

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g31305 not represented in the dataset	Glyma17g31305 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g31305 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g208100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g31305

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g31305

Limit To All Plant Sequences

>Glyma17g31305.1   sequence type=CDS   gene model=Glyma17g31305   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGTGCTCCCACTCCATGCGAAGAGTTTGTGTACATGGCGAAGCTAGTGGAACAAGTCAAGCATTATGAGGAGATGGTGGAGTTCATGGAGAAGGTCTTTGCCTCTACCGAGAGCGAGGAGCTAACCGTGGACGAGCGCAACCTCCTCTCCAAGGAGGACCACCTTGTCGTCATCCGCAACTACCGCTCCAAGATCAAGGTCGAGCTCTCCAACATCTACGACAAAATCCTCAAACTCCTCGACACGCACCTAGTCCCCTCCCTCACCTCTGGTGACTCGAAGGTCTTCTACCTCAAGATGAAGGGAGCCTACCACAGGTACTTCACTGAGTTCAAGATCGATGCCAACCGCAAGGAGGCCGTCGAGAGCCCGCTCTCTACCTACAAAGCTGCTCAAATTTGCTTTTTCTTTTTTTCTTTCGATTTTTTGGATTTTTATTTTGTGATGTAG

Predicted protein sequences of Glyma17g31305

Limit To All Plant Sequences

>Glyma17g31305.1   sequence type=predicted peptide   gene model=Glyma17g31305   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASAPTPCEEFVYMAKLVEQVKHYEEMVEFMEKVFASTESEELTVDERNLLSKEDHLVVIRNYRSKIKVELSNIYDKILKLLDTHLVPSLTSGDSKVFYLKMKGAYHRYFTEFKIDANRKEAVESPLSTYKAAQICFFFFSFDFLDFYFVM*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain