Glyma17g31060 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g31060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g31060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g31060

Feature Type:	gene_model
Chromosome:	Gm17
Start:	34198811
stop:	34201818
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g31060

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G25610	AT	Annotation by Michelle Graham. TAIR10: ATPase, F0/V0 complex, subunit C protein \| chr2:10901585-10902494 REVERSE LENGTH=178	SoyBase	E_val: 3.00E-107	ISS
GO:0015991	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP hydrolysis coupled proton transport	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0033177	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting two-sector ATPase complex, proton-transporting domain	SoyBase	N/A	ISS
GO:0033179	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: proton-transporting V-type ATPase, V0 domain	SoyBase	N/A	ISS
GO:0015078	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrogen ion transmembrane transporter activity	SoyBase	N/A	ISS
GO:0016887	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATPase activity	SoyBase	N/A	ISS
KOG0233	KOG	Vacuolar H+-ATPase V0 sector, subunit c''	JGI		ISS
PTHR10263	Panther	VACUOLAR ATP SYNTHASE PROTEOLIPID SUBUNIT	JGI		ISS
PTHR10263:SF1	Panther	VACUOLAR ATP SYNTHASE PROTEOLIPID SUBUNIT	JGI		ISS
PF00137	PFAM	ATP synthase subunit C	JGI		ISS
UniRef100_C6T3I8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T3I8_SOYBN	SoyBase	E_val: 1.00E-115	ISS
UniRef100_Q84V02	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar membrane ATPase subunit c'' n=1 Tax=Citrus limon RepID=Q84V02_CITLI	SoyBase	E_val: 8.00E-108	ISS

Expression Patterns of Glyma17g31060

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g31060 not represented in the dataset	Glyma17g31060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g31060

Paralog	Evidence	Comments
Glyma14g15345	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g31060 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g206600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g31060

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g31060

Limit To All Plant Sequences

>Glyma17g31060.1   sequence type=CDS   gene model=Glyma17g31060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGCACATTCGAGTTCTTGGGGAAGGGCACTCGTCGCGATCTCGCCCTACACCTTCTCCGCCATCGGCATCGCCGTCGCTATCGGCGTCTCCGTCCTCGGCGCCGCCTGGGGGATCTACATCACCGGAAGCAGCTTGATCGGCGCTGCAATCAGGGCTCCTCGAATCACTTCCAAAAATCTCATTAGTGTAATCTTCTGTGAAGCTGTTGCTATATATGGTGTTATTGTGGCTATTATTCTTCAAACCAAATTAGAAAGTGTTCCAGCATCAAATATTTATGCACCAGAGTCTCTTAGGGCTGGATATGCAATCTTTGCATCGGGATTAATTGTGGGCTTCGCAAATCTTGTTTGTGGGTTGTGTGTAGGAATAATTGGAAGCAGCTGTGCATTGTCTGATGCCCAGAACTCCTCTCTCTTTGTGAAAATTCTTGTGATCGAGATCTTTGGTAGTGCGCTGGGGCTATTTGGAGTTATTGTTGGAATAATTATGTCAGCTCAAGCAACATGGCCAACGAAAGTTTAG

Predicted protein sequences of Glyma17g31060

Limit To All Plant Sequences

>Glyma17g31060.1   sequence type=predicted peptide   gene model=Glyma17g31060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVAHSSSWGRALVAISPYTFSAIGIAVAIGVSVLGAAWGIYITGSSLIGAAIRAPRITSKNLISVIFCEAVAIYGVIVAIILQTKLESVPASNIYAPESLRAGYAIFASGLIVGFANLVCGLCVGIIGSSCALSDAQNSSLFVKILVIEIFGSALGLFGVIVGIIMSAQATWPTKV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain