SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g31050

Feature Type:gene_model
Chromosome:Gm17
Start:34187027
stop:34188497
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g31050
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G18790AT Annotation by Michelle Graham. TAIR10: Ribosomal protein L33 family protein | chr5:6266324-6266500 REVERSE LENGTH=58 SoyBaseE_val: 2.00E-25ISS
GO:0006412GO-bp Annotation by Michelle Graham. GO Biological Process: translation SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ribosome SoyBaseN/AISS
GO:0015934GO-cc Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit SoyBaseN/AISS
GO:0003735GO-mf Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome SoyBaseN/AISS
KOG3505 KOG Mitochondrial/chloroplast ribosomal protein L33-like JGI ISS
PTHR15238Panther FAMILY NOT NAMED JGI ISS
PF00471PFAM Ribosomal protein L33 JGI ISS
UniRef100_C6TLC5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TLC5_SOYBN SoyBaseE_val: 1.00E-32ISS
UniRef100_G7I920UniRef Annotation by Michelle Graham. Most informative UniRef hit: 50S ribosomal protein L33 n=1 Tax=Medicago truncatula RepID=G7I920_MEDTR SoyBaseE_val: 2.00E-31ISS

Expression Patterns of Glyma17g31050
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g31050
ParalogEvidenceComments
Glyma14g15370 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g31050 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g206500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g31050
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g31050
>Glyma17g31050.1   sequence type=CDS   gene model=Glyma17g31050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGACAAAAAGAAGAAGGCTCAGATGTTTGTAAAGCTAGTGTCTGCTGCTGGGACTGGATTTTTCTATGTTAAGAGGAAGCCAAGGCAGTTCACAGAGAAGCTTGAGTTCCGAAAATATGATCCTAGGGTTAATCGTCACGTTCTGTTTACAGAGGCTAAAATGAAATGA
Predicted protein sequences of Glyma17g31050
>Glyma17g31050.1   sequence type=predicted peptide   gene model=Glyma17g31050   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGDKKKKAQMFVKLVSAAGTGFFYVKRKPRQFTEKLEFRKYDPRVNRHVLFTEAKMK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo