SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g29540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g29540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g29540

Feature Type:gene_model
Chromosome:Gm17
Start:32215829
stop:32221736
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g29540
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G53045AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 122 Blast hits to 122 proteins in 57 species: Archae - 0; Bacteria - 0; Metazoa - 46; Fungi - 30; Plants - 41; Viruses - 0; Other Eukaryotes - 5 (source: NCBI BLink). | chr5:21508603-21509538 REVERSE LENGTH=96 SoyBaseE_val: 7.00E-37ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF09341PFAM Transcription factor Pcc1 JGI ISS
UniRef100_E4YK26UniRef Annotation by Michelle Graham. Most informative UniRef hit: Whole genome shotgun assembly, allelic scaffold set, scaffold scaffoldA_410 n=1 Tax=Oikopleura dioica RepID=E4YK26_OIKDI SoyBaseE_val: 6.00E-09ISS
UniRef100_I1MWH3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MWH3_SOYBN SoyBaseE_val: 1.00E-58ISS

Expression Patterns of Glyma17g29540
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g29540 not represented in the dataset
Glyma17g29540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma17g29540
ParalogEvidenceComments
Glyma11g17990 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma17g29540 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g200500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g29540
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g29540
>Glyma17g29540.1   sequence type=CDS   gene model=Glyma17g29540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACACCACCACAATGGGAATTTAGCTGTGACATGGAAATGTATTTTGGATCGGAGGAGAATGCTTCCATTGTGTATGCTGCCTTAGCAGTTGACAAAGAGCCTGATAAAGTAAAACGACTTATGACAGTGTCTGATGGAAAGCTATCAGTGCACTTTGAGGCAACAGAAGCCAGATTTCTTCGGGCATCATTTAGTGCTTTTGTAGATGTCCTGACACTAGCCACCAAAACTATTGAAGAATTTGGTCAAGTAATGAAGTTGTGA
Predicted protein sequences of Glyma17g29540
>Glyma17g29540.1   sequence type=predicted peptide   gene model=Glyma17g29540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATPPQWEFSCDMEMYFGSEENASIVYAALAVDKEPDKVKRLMTVSDGKLSVHFEATEARFLRASFSAFVDVLTLATKTIEEFGQVMKL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo