Glyma17g27541 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g27541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g27541): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g27541

Feature Type:	gene_model
Chromosome:	Gm17
Start:	29344602
stop:	29344975
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g27541

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G18790	AT	Annotation by Michelle Graham. TAIR10: FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: Isy1-like splicing (InterPro:IPR009360); Has 1147 Blast hits to 965 proteins in 236 species: Archae - 12; Bacteria - 13; Metazoa - 351; Fungi - 230; Plants - 49; Viruses - 9; Other Eukaryotes - 483 (source: NCBI BLink). \| chr3:6477853-6478755 FORWARD LENGTH=300	SoyBase	E_val: 3.00E-16	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR13021	Panther	FAMILY NOT NAMED	JGI		ISS
UniRef100_B9S3Q1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pre-mRNA-splicing factor isy-1, putative n=1 Tax=Ricinus communis RepID=B9S3Q1_RICCO	SoyBase	E_val: 4.00E-15	ISS
UniRef100_UPI000233D32D	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233D32D related cluster n=1 Tax=unknown RepID=UPI000233D32D	SoyBase	E_val: 2.00E-21	ISS

Expression Patterns of Glyma17g27541

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g27541 not represented in the dataset	Glyma17g27541 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g27541 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g27541

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g27541

Limit To All Plant Sequences

>Glyma17g27541.1   sequence type=CDS   gene model=Glyma17g27541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGAGGCAATGAGGCGGGAGGCGGCGGAGGAGTGGAGGAGGGAGAGGAGGGAGTTTGTGGTGCACGTGCTGCTGCTGGATGAGAAGGAGATTGGGAGGAGGGTGCTGGAGAAGAAGAAGAAGGATCTGTTGAGTAGGTACACGAGTGAGGGGCTTGTGGAGGAGCAGACTGAGGCCAAGGACATGCTCAACATTCAGCGTTAG

Predicted protein sequences of Glyma17g27541

Limit To All Plant Sequences

>Glyma17g27541.1   sequence type=predicted peptide   gene model=Glyma17g27541   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEAMRREAAEEWRRERREFVVHVLLLDEKEIGRRVLEKKKKDLLSRYTSEGLVEEQTEAKDMLNIQR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain