SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g27250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g27250): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g27250

Feature Type:gene_model
Chromosome:Gm17
Start:28691821
stop:28693848
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G00660AT Annotation by Michelle Graham. TAIR10: RNAhelicase-like 8 | chr4:274638-277438 FORWARD LENGTH=505 SoyBaseE_val: 3.00E-168ISS
GO:0016032GO-bp Annotation by Michelle Graham. GO Biological Process: viral reproduction SoyBaseN/AISS
GO:0019048GO-bp Annotation by Michelle Graham. GO Biological Process: virus-host interaction SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0004386GO-mf Annotation by Michelle Graham. GO Molecular Function: helicase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0008026GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity SoyBaseN/AISS
KOG0327 KOG Translation initiation factor 4F, helicase subunit (eIF-4A) and related helicases JGI ISS
PTHR24031Panther FAMILY NOT NAMED JGI ISS
PTHR24031:SF6Panther SUBFAMILY NOT NAMED JGI ISS
PF00270PFAM DEAD/DEAH box helicase JGI ISS
PF00271PFAM Helicase conserved C-terminal domain JGI ISS
UniRef100_B9RDP2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Dead box ATP-dependent RNA helicase, putative n=1 Tax=Ricinus communis RepID=B9RDP2_RICCO SoyBaseE_val: 5.00E-173ISS
UniRef100_I1MWB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MWB6_SOYBN SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g27250 not represented in the dataset

Glyma17g27250 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g27250.2   sequence type=CDS   gene model=Glyma17g27250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAAACTAAAGGAAATGAGTTTGAGGATTACTTTTTGAAGCGTGAGTTGCTCATGGGAATATATGCGAAGGGTTTTGAAAGGCCTTCTCCCATCCAAGAAGAAAGCATTTCGATTGCTTTTACTGGTAGTGACATTCTTGCTAGGGCTAAGAACGGAACTGGCAAAACAGCTGCATTTTGCATTCCTGCATTGGATAAAATTGACCAGGACAATAATGTTAGTCAAGTGTGCAAAGAGCTTGGAAAGCACTTGAAAATTCAAGTTATGGTTACAACAGGTGGTACCAGCCTGAAAGATGATATAATGTTCTTATATCAACCAGTTCATTTACTAGTTGGAACTCTAGGAAGAATATTAGATCTTGCCAAGAAAGGTGTTTGTATTCTGAAAGATTGTGCTATGCTTGTTATGGATGAGGCCGATAAGCTTATGTCCCCAGAGTTTCAACCTTCTATAGAGCAGCTGATTCATTTTCTTCCTACAACTCGTCAAATCTTGATGTTTTTAGCAACATTTCCTGTTACTGTAAAGGATTTCAAGGATAGGTATCTTCGAAAACCTTATGTATTCGTGGAAGAGAGACAGAAAGTCCACTGTCTAAATACTCTTTTTTCTAAGCTGCAAATAACCCAGTCTATCATCTTCTGCAATTCAGTAAATCGGGTTGAACTCCTTGCCAAGAAAATCACAGAACTTGGGTATTCATGTATCTACATTCATGCAAAGATGTTGCAAGACCATCGTAACAGAGTGTTTCATGACTTCCGCAATGGCGCATGTCGAAATCTTGTTTGTACTGGT

>Glyma17g27250.2   sequence type=predicted peptide   gene model=Glyma17g27250   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKTKGNEFEDYFLKRELLMGIYAKGFERPSPIQEESISIAFTGSDILARAKNGTGKTAAFCIPALDKIDQDNNVSQVCKELGKHLKIQVMVTTGGTSLKDDIMFLYQPVHLLVGTLGRILDLAKKGVCILKDCAMLVMDEADKLMSPEFQPSIEQLIHFLPTTRQILMFLATFPVTVKDFKDRYLRKPYVFVEERQKVHCLNTLFSKLQITQSIIFCNSVNRVELLAKKITELGYSCIYIHAKMLQDHRNRVFHDFRNGACRNLVCTG







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo