Report for Sequence Feature Glyma17g25950
Feature Type: gene_model
Chromosome: Gm17
Start: 26982525
stop: 26986035
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma17g25950
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G25752 AT
Annotation by Michelle Graham. TAIR10: rhomboid-like protein 11 | chr5:8951503-8953323 REVERSE LENGTH=280
SoyBase E_val: 5.00E-119 ISS
GO:0080140 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of jasmonic acid metabolic process
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0009706 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane
SoyBase N/A ISS
GO:0004252 GO-mf
Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity
SoyBase N/A ISS
PTHR22936 Panther
RHOMBOID-RELATED
JGI ISS
PF01694 PFAM
Rhomboid family
JGI ISS
UniRef100_C6T841 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T841_SOYBN
SoyBase E_val: 0 ISS
UniRef100_G7I4B9 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Rhomboid family protein (ISS) n=1 Tax=Medicago truncatula RepID=G7I4B9_MEDTR
SoyBase E_val: 5.00E-120 ISS
Expression Patterns of Glyma17g25950
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma17g25950 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.17g190400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma17g25950
Coding sequences of Glyma17g25950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma17g25950.1 sequence type=CDS gene model=Glyma17g25950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGCGCAGCAACTTGGAGTTCCATTTAAGTTATCATGCAAACCCTCTCACATTCACGCTCTTAAACCCTTTCACTCTCTCCCTCCCCTTCGCACCTTCACCCCCAAACCTTCTCTTAATGCCAAATCCCATCATCATCATCATCCTTTATTAACGCTTCTTCGTTCCCACCGCACTCTCGCACCCTGCTGCAACTCCAACAAATCAGATATAATGTCACAATTGGAGCTTGGGAAACCGGAGCAAAAGGGGAAACCGGAGAAGCGAGTAAATGGTATATTCTGGATCATTCTCCTCAACATTGCCATATTCGTCGCTGACCACTTTTTTCGGGTTAATGGGATCAAGGCTTTATACTTGTACCACAATTGGCCTTCTTGGTACCAGTTTGTCACAGCTACATTTTGTCATGCTAATTGGAAGCATCTTTCTAGCAACCTTTTCTTCTTGTACATTTTTGGAAAGCTTGTTGAAGAAGAGGAAGGGAACTTTGCTTTGTGGCTTTCTTACATTCTTACTGGTGTAGGAGCCAACCTTGTTTCATGGTTGGTTTTACCAAGAAATACGGTTTCTGTTGGAGCTTCTGGTGCTGTTTTCGGGTTATTTTCTATCAGTGTCCTTGTAAAGATGTCCTGGGATTGGAGGAAGATCCTTGAAGTGCTTATATTGGGTCAGTTTGTTATAGAGAAGGTCATGGAAGCAGCCCAAGCTTCAACATCATTGTCAGGCCGAGGAGGCTACGCATTGCAAAGTGTAAATCACATTGCACATCTTTCTGGTGCTCTTGTTGGTGTGCTTTTGGTTTGGCTCCTTAGCAAAGTTCCTTCAGATCCTTCTGACCAATAA
Predicted protein sequences of Glyma17g25950
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma17g25950.1 sequence type=predicted peptide gene model=Glyma17g25950 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MAQQLGVPFKLSCKPSHIHALKPFHSLPPLRTFTPKPSLNAKSHHHHHPLLTLLRSHRTLAPCCNSNKSDIMSQLELGKPEQKGKPEKRVNGIFWIILLNIAIFVADHFFRVNGIKALYLYHNWPSWYQFVTATFCHANWKHLSSNLFFLYIFGKLVEEEEGNFALWLSYILTGVGANLVSWLVLPRNTVSVGASGAVFGLFSISVLVKMSWDWRKILEVLILGQFVIEKVMEAAQASTSLSGRGGYALQSVNHIAHLSGALVGVLLVWLLSKVPSDPSDQ*