SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma17g25908

Feature Type:gene_model
Chromosome:Gm17
Start:26980550
stop:26981232
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25630AT Annotation by Michelle Graham. TAIR10: Tetratricopeptide repeat (TPR)-like superfamily protein | chr5:8947426-8949424 FORWARD LENGTH=574 SoyBaseE_val: 3.00E-73ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
PTHR24349Panther SERINE/THREONINE-PROTEIN KINASE JGI ISS
PTHR24349:SF45Panther JGI ISS
PF01535PFAM PPR repeat JGI ISS
UniRef100_G7I4C0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Pentatricopeptide repeat-containing protein n=1 Tax=Medicago truncatula RepID=G7I4C0_MEDTR SoyBaseE_val: 1.00E-94ISS
UniRef100_UPI000233E549UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E549 related cluster n=1 Tax=unknown RepID=UPI000233E549 SoyBaseE_val: 4.00E-159ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g25908 not represented in the dataset

Glyma17g25908 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g190300 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g25908.1   sequence type=CDS   gene model=Glyma17g25908   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGAATTTTACATCCGACCAGATGTGATAACATATAGTACTATAATGAATGCATGGAGCCAAGCTGGATTCTTGGAAAAATGCAAGGAAATCTACAATAACATGTTAAAATCTGGTGTGAAGCCGGATGGACATGCTTATAGTATTCTTGCTAAAGGTTATGTGCGAGCACAAGAAATGGAAAAGGCTGAAGAACTGCTTACTGTCATGACTAAATCAGGTGTCCAACCAAATGTTGTTATATTTACAACTGTGATGAGTGGATGGTGCAGTGTTGGCAGAATGGACAATGCCATGAGGGTTTTTGACAAGATGGGTGAATTTGGGGTTTCTCCAAATTTGAAGACTTTTGAGACACTAATCTGGGGATATGCAGAAGCAAAACAACCCTGGAAAGCAGAAGGAATGTTGCAAATAATGGAAGAGTTTCATGTTCAACCCAAGAAATCGACCATTTTGCTTGTTGCAGAAGCTTGGTGTTTTGCTGGATTGAAAGAAGGGGCAAAGACACTACTGATTACTGTAAAAACTGAGAAGATGATCAATTCAATAGATGGAGACAACAATATAACTGCTAAAATGTCAGAGAAAATTTGCCAAAAGCCACATACTAATGCTCCTTTTTGTAGTCTCTTAAAAGACTTCATCTATATCTTCCACTGA

>Glyma17g25908.1   sequence type=predicted peptide   gene model=Glyma17g25908   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEEFYIRPDVITYSTIMNAWSQAGFLEKCKEIYNNMLKSGVKPDGHAYSILAKGYVRAQEMEKAEELLTVMTKSGVQPNVVIFTTVMSGWCSVGRMDNAMRVFDKMGEFGVSPNLKTFETLIWGYAEAKQPWKAEGMLQIMEEFHVQPKKSTILLVAEAWCFAGLKEGAKTLLITVKTEKMINSIDGDNNITAKMSEKICQKPHTNAPFCSLLKDFIYIFH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo