SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g25742): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g25742): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g25742

Feature Type:gene_model
Chromosome:Gm17
Start:26840787
stop:26843069
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G07110AT Annotation by Michelle Graham. TAIR10: fructose-2,6-bisphosphatase | chr1:2178363-2183980 REVERSE LENGTH=744 SoyBaseE_val: 6.00E-38ISS
GO:0006000GO-bp Annotation by Michelle Graham. GO Biological Process: fructose metabolic process SoyBaseN/AISS
GO:0006002GO-bp Annotation by Michelle Graham. GO Biological Process: fructose 6-phosphate metabolic process SoyBaseN/AISS
GO:0006003GO-bp Annotation by Michelle Graham. GO Biological Process: fructose 2,6-bisphosphate metabolic process SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0042732GO-bp Annotation by Michelle Graham. GO Biological Process: D-xylose metabolic process SoyBaseN/AISS
GO:0043609GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of carbon utilization SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0003873GO-mf Annotation by Michelle Graham. GO Molecular Function: 6-phosphofructo-2-kinase activity SoyBaseN/AISS
GO:0004331GO-mf Annotation by Michelle Graham. GO Molecular Function: fructose-2,6-bisphosphate 2-phosphatase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0030246GO-mf Annotation by Michelle Graham. GO Molecular Function: carbohydrate binding SoyBaseN/AISS
GO:2001070GO-mf Annotation by Michelle Graham. GO Molecular Function: starch binding SoyBaseN/AISS
PTHR10606Panther 6-PHOSPHOFRUCTO-2-KINASE/FRUCTOSE-2,6-BISPHOSPHATASE JGI ISS
PTHR10606:SF7Panther FRUCTOSE-6-PHOSPHATE,2-KINASE/FRUCTOSE-2, 6-BISPHOSPHATASE JGI ISS
PF00300PFAM Phosphoglycerate mutase family JGI ISS
UniRef100_G7K733UniRef Annotation by Michelle Graham. Most informative UniRef hit: 6-phosphofructo-2-kinase/fructose-2, 6-biphosphatase n=1 Tax=Medicago truncatula RepID=G7K733_MEDTR SoyBaseE_val: 4.00E-41ISS
UniRef100_UPI000233A8F6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233A8F6 related cluster n=1 Tax=unknown RepID=UPI000233A8F6 SoyBaseE_val: 4.00E-57ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g25742 not represented in the dataset

Glyma17g25742 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g25742.1   sequence type=CDS   gene model=Glyma17g25742   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGAGGCTGGAGAACTTTATTCAAAGAAGCTTGCCAAGTTTGTTGGAAAGCGTCTCAAATCAGAATGGGCTGCTTCTATATGGACTAGTACACTGCAACGAACAATTCTGACAGCCACTCCAATTATTGGATTTCCCAAGATACAATGGCGTGCACTTGATGAGATAAACGCAGGGGTGTGTGATGGTATGGCATATGCAGAAATCAAGAAAAACATGCCAGAGGAGTATGAGTATATAGGAACGGAAATCCTTATGGAATAG

>Glyma17g25742.1   sequence type=predicted peptide   gene model=Glyma17g25742   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEAGELYSKKLAKFVGKRLKSEWAASIWTSTLQRTILTATPIIGFPKIQWRALDEINAGVCDGMAYAEIKKNMPEEYEYIGTEILME*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo