SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g25660

Feature Type:gene_model
Chromosome:Gm17
Start:26718037
stop:26719234
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g25660
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G49890AT Annotation by Michelle Graham. TAIR10: chloride channel C | chr5:20288489-20292143 REVERSE LENGTH=779 SoyBaseE_val: 3.00E-45ISS
GO:0006821GO-bp Annotation by Michelle Graham. GO Biological Process: chloride transport SoyBaseN/AISS
GO:0055085GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0009705GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005216GO-mf Annotation by Michelle Graham. GO Molecular Function: ion channel activity SoyBaseN/AISS
GO:0005247GO-mf Annotation by Michelle Graham. GO Molecular Function: chloride transport SoyBaseN/AISS
GO:0005253GO-mf Annotation by Michelle Graham. GO Molecular Function: anion channel activity SoyBaseN/AISS
PTHR11689Panther CHLORIDE CHANNEL JGI ISS
PTHR11689:SF11Panther CHLORIDE CHANNEL JGI ISS
PF00654PFAM Voltage gated chloride channel JGI ISS
UniRef100_I1L3P4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L3P4_SOYBN SoyBaseE_val: 4.00E-48ISS
UniRef100_Q8LPA2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chloride channel n=1 Tax=Oryza sativa Japonica Group RepID=Q8LPA2_ORYSJ SoyBaseE_val: 8.00E-44ISS

Expression Patterns of Glyma17g25660
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g25660 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g25660
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g25660
>Glyma17g25660.1   sequence type=CDS   gene model=Glyma17g25660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGATATCTTGATGCTTTTTTAGCATATGCTGGTGTGAATATGTGCTTAGTAGCAGCTGCTGCTGCACTTTGTGCTTTCATTGCTCCAGCAACTGTAGGCTCTGGCATTCCAGAGGTAAAAGCATATCTCAATGGCGTCGATGCTCAAAATATATTGGCTCCAAGCACCCTTTTTGTAAAGAAATTTCACATAACTAGATACGTTGAAAATGTTATTAGGATTTCATTAGAGAATACAACCACAACAAGAAAATATTTTTTGCCACTAGGTGTAGCTTGTTACACCCCCTTAGCTTGTGTTGATTCATTCCTAATACATCGTGCTTTTCCCCTTTTAAGTGTTTCTACTGGATTTGTGGTGGGCAAAGAGGGGCCTATTGTACATACAGGTGCATGCATAACTTCTTTATTGGGGCAGGGTGGATCTCCCAAGTATCACTTGACTTGCACTTGGCTTAGATGTTTCAAAAATGACCGAGACTGGCGGGGCATGATTACTTGTGGGTTACTGCCGGTGTTGCTGTCGCTTTTC
Predicted protein sequences of Glyma17g25660
>Glyma17g25660.1   sequence type=predicted peptide   gene model=Glyma17g25660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RYLDAFLAYAGVNMCLVAAAAALCAFIAPATVGSGIPEVKAYLNGVDAQNILAPSTLFVKKFHITRYVENVIRISLENTTTTRKYFLPLGVACYTPLACVDSFLIHRAFPLLSVSTGFVVGKEGPIVHTGACITSLLGQGGSPKYHLTCTWLRCFKNDRDWRGMITCGLLPVLLSLF






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo