Glyma17g25660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g25660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g25660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g25660

Feature Type:	gene_model
Chromosome:	Gm17
Start:	26718037
stop:	26719234
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g25660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G49890	AT	Annotation by Michelle Graham. TAIR10: chloride channel C \| chr5:20288489-20292143 REVERSE LENGTH=779	SoyBase	E_val: 3.00E-45	ISS
GO:0006821	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloride transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005622	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: intracellular	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0009705	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005216	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ion channel activity	SoyBase	N/A	ISS
GO:0005247	GO-mf	Annotation by Michelle Graham. GO Molecular Function: chloride transport	SoyBase	N/A	ISS
GO:0005253	GO-mf	Annotation by Michelle Graham. GO Molecular Function: anion channel activity	SoyBase	N/A	ISS
PTHR11689	Panther	CHLORIDE CHANNEL	JGI		ISS
PTHR11689:SF11	Panther	CHLORIDE CHANNEL	JGI		ISS
PF00654	PFAM	Voltage gated chloride channel	JGI		ISS
UniRef100_I1L3P4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1L3P4_SOYBN	SoyBase	E_val: 4.00E-48	ISS
UniRef100_Q8LPA2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chloride channel n=1 Tax=Oryza sativa Japonica Group RepID=Q8LPA2_ORYSJ	SoyBase	E_val: 8.00E-44	ISS

Expression Patterns of Glyma17g25660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g25660 not represented in the dataset	Glyma17g25660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g25660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g25660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g25660

Limit To All Plant Sequences

>Glyma17g25660.1   sequence type=CDS   gene model=Glyma17g25660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AGATATCTTGATGCTTTTTTAGCATATGCTGGTGTGAATATGTGCTTAGTAGCAGCTGCTGCTGCACTTTGTGCTTTCATTGCTCCAGCAACTGTAGGCTCTGGCATTCCAGAGGTAAAAGCATATCTCAATGGCGTCGATGCTCAAAATATATTGGCTCCAAGCACCCTTTTTGTAAAGAAATTTCACATAACTAGATACGTTGAAAATGTTATTAGGATTTCATTAGAGAATACAACCACAACAAGAAAATATTTTTTGCCACTAGGTGTAGCTTGTTACACCCCCTTAGCTTGTGTTGATTCATTCCTAATACATCGTGCTTTTCCCCTTTTAAGTGTTTCTACTGGATTTGTGGTGGGCAAAGAGGGGCCTATTGTACATACAGGTGCATGCATAACTTCTTTATTGGGGCAGGGTGGATCTCCCAAGTATCACTTGACTTGCACTTGGCTTAGATGTTTCAAAAATGACCGAGACTGGCGGGGCATGATTACTTGTGGGTTACTGCCGGTGTTGCTGTCGCTTTTC

Predicted protein sequences of Glyma17g25660

Limit To All Plant Sequences

>Glyma17g25660.1   sequence type=predicted peptide   gene model=Glyma17g25660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RYLDAFLAYAGVNMCLVAAAAALCAFIAPATVGSGIPEVKAYLNGVDAQNILAPSTLFVKKFHITRYVENVIRISLENTTTTRKYFLPLGVACYTPLACVDSFLIHRAFPLLSVSTGFVVGKEGPIVHTGACITSLLGQGGSPKYHLTCTWLRCFKNDRDWRGMITCGLLPVLLSLF

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain