SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g24322): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g24322): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g24322

Feature Type:gene_model
Chromosome:Gm17
Start:24721204
stop:24722957
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G17920AT Annotation by Michelle Graham. TAIR10: Cobalamin-independent synthase family protein | chr5:5935771-5939195 FORWARD LENGTH=765 SoyBaseE_val: 0ISS
GO:0008652GO-bp Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process SoyBaseN/AISS
GO:0009086GO-bp Annotation by Michelle Graham. GO Biological Process: methionine biosynthetic process SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010043GO-bp Annotation by Michelle Graham. GO Biological Process: response to zinc ion SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005777GO-cc Annotation by Michelle Graham. GO Cellular Compartment: peroxisome SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0003871GO-mf Annotation by Michelle Graham. GO Molecular Function: 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
GO:0008705GO-mf Annotation by Michelle Graham. GO Molecular Function: methionine synthase activity SoyBaseN/AISS
PTHR19960Panther TEKTIN RELATED JGI ISS
PTHR19960:SF21Panther 5-METHYLTETRAHYDROPTEROYLTRIGLUTAMATE--HOMOCYSTEIN JGI ISS
PF08267PFAM Cobalamin-independent synthase, N-terminal domain JGI ISS
UniRef100_Q71EW8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Methionine synthase n=2 Tax=Papilionoideae RepID=Q71EW8_SOYBN SoyBaseE_val: 0ISS
UniRef100_UPI000233F20DUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F20D related cluster n=1 Tax=unknown RepID=UPI000233F20D SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g24322 not represented in the dataset

Glyma17g24322 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g188000 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma17g24322.1   sequence type=CDS   gene model=Glyma17g24322   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTTCTCATATTGTTGGATACCCCCGCATGGGCCCCAAGAGAGAGCTGAAGTTTGCATTGGAGTCATTCTGGGATGGAAAGAGCAGTGCCGATGATTTGAAGAAGGTGGCTTTTGATCTCAGGGCATCCATTTGGAAGCAGATGATTGATGCTGGGATCAAGTACATCCCCAACAACACTTTCTCATACTACGATCAGGTGCTTGATACTACCGCCATGCTTGGCGCCGTTCCACCCAGATATGGATGGAACAGCGAAGAAATAGGGTTTGATACCTTTTTCTCCATGGCCAGAGGTAATGCATCTGTGCCTACCATGGAGATGACCAAGTGGTTTGACACCAACTACCACTTTATTGTCCCCGAGTTGGGACCTGATGTGAATTTCAGTTATGCTTCCCACAAGGCAGTGAATGAGTACAAGGAAGCCAAGGCGCTTGGAGTAGATACAGTTCCAGTCCTCATTGGCCCTGTATCATACTTGGTGCTCTCCAAACCTGCCAAGGGTGTTGATAAATCCTTTTGTCTTCTTTCTCTCCTCCCAAAAGTCCTTGCTATCTATAGGGAAGTTGTGGCTGATCTTAAGCAAGCTGGTGCTTCGTGGATTCAATTTGACGAACCTATCCTTGTCTTGGACCTTGGCTCTCAAACGTTGCAAGCACTTACTGCAGCATACGCAGAACTTGAATCTACTCTATCGGGTTTAAATGTTCTTATTGAGACCTACTTTGCTGACATTCCTGTAGAGGCATACCAGACCCTCACAGCTCTTAATGGAGTTGCAGCATTTGGATTTGATTTAGTCCGTGGAACTAAGACTCTTGATCTAATCAAGGGTGGATTTCCCAGTGGAAAATACTTGTTTGCTGGCGTGGTGGATGGAAGGAACATCTGGGCTAATAATCTCACTGCTTCTCTTGATACATTAAATAGTCTTGAGGGAATTGTGGGAAAA

>Glyma17g24322.1   sequence type=predicted peptide   gene model=Glyma17g24322   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASHIVGYPRMGPKRELKFALESFWDGKSSADDLKKVAFDLRASIWKQMIDAGIKYIPNNTFSYYDQVLDTTAMLGAVPPRYGWNSEEIGFDTFFSMARGNASVPTMEMTKWFDTNYHFIVPELGPDVNFSYASHKAVNEYKEAKALGVDTVPVLIGPVSYLVLSKPAKGVDKSFCLLSLLPKVLAIYREVVADLKQAGASWIQFDEPILVLDLGSQTLQALTAAYAELESTLSGLNVLIETYFADIPVEAYQTLTALNGVAAFGFDLVRGTKTLDLIKGGFPSGKYLFAGVVDGRNIWANNLTASLDTLNSLEGIVGK







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo