SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g23881

Feature Type:gene_model
Chromosome:Gm17
Start:24001990
stop:24003012
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g23881
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00710AT Annotation by Michelle Graham. TAIR10: photosystem II reaction center protein H | chrC:74485-74706 FORWARD LENGTH=73 SoyBaseE_val: 8.00E-32ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0009769GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light harvesting in photosystem II SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0050821GO-bp Annotation by Michelle Graham. GO Biological Process: protein stabilization SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0042301GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphate ion binding SoyBaseN/AISS
PF00737PFAM Photosystem II 10 kDa phosphoprotein JGI ISS
UniRef100_Q2PMQ6UniRef Annotation by Michelle Graham. Best UniRef hit: Photosystem II reaction center protein H n=1 Tax=Glycine max RepID=PSBH_SOYBN SoyBaseE_val: 1.00E-32ISS
UniRef100_Q2PMQ6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Photosystem II reaction center protein H n=1 Tax=Glycine max RepID=PSBH_SOYBN SoyBaseE_val: 1.00E-32ISS

Expression Patterns of Glyma17g23881
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g23881 not represented in the dataset
Glyma17g23881 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g23881 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g186400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g23881
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g23881
>Glyma17g23881.1   sequence type=CDS   gene model=Glyma17g23881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTACGCAAACCGTTGAAGATAATTCTAGATCTGGTCCAAGACGAACTGTTGTAGGTGATTTATTGAAACCATTAAATTTAGAATATGGTAAAGTAGCTCCGGGGTGGGGAACTACTCCCTTGATGGGTGTTGCAATGGCTATATTTGCGATATTTCTATCTATTATTTTGGGTAGGAAGTGTAGTCGCCAAAAGGCGAGTTGA
Predicted protein sequences of Glyma17g23881
>Glyma17g23881.1   sequence type=predicted peptide   gene model=Glyma17g23881   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MATQTVEDNSRSGPRRTVVGDLLKPLNLEYGKVAPGWGTTPLMGVAMAIFAIFLSIILGRKCSRQKAS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo