Glyma17g23845 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g23845): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g23845): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g23845

Feature Type:	gene_model
Chromosome:	Gm17
Start:	23971749
stop:	23972458
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g23845

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATMG00650	AT	Annotation by Michelle Graham. TAIR10: NADH dehydrogenase subunit 4L \| chrM:188929-189231 REVERSE LENGTH=100	SoyBase	E_val: 3.00E-54	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0042773	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled electron transport	SoyBase	N/A	ISS
GO:0045333	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular respiration	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0045271	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: respiratory chain complex I	SoyBase	N/A	ISS
GO:0003954	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity	SoyBase	N/A	ISS
GO:0016651	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H	SoyBase	N/A	ISS
KOG4669	KOG	NADH dehydrogenase subunit 4L and related proteins	JGI		ISS
PTHR11434	Panther	NADH-UBIQUINONE OXIDOREDUCTASE SUBUNIT ND4L	JGI		ISS
PF00420	PFAM	NADH-ubiquinone/plastoquinone oxidoreductase chain 4L	JGI		ISS
UniRef100_E9KZN8	UniRef	Annotation by Michelle Graham. Best UniRef hit: NADH dehydrogenase subunit 4L n=1 Tax=Vigna radiata RepID=E9KZN8_VIGRA	SoyBase	E_val: 5.00E-53	ISS
UniRef100_E9KZN8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NADH dehydrogenase subunit 4L n=1 Tax=Vigna radiata RepID=E9KZN8_VIGRA	SoyBase	E_val: 5.00E-53	ISS

Expression Patterns of Glyma17g23845

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g23845 not represented in the dataset	Glyma17g23845 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g23845 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma17g23845

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g23845

Limit To All Plant Sequences

>Glyma17g23845.1   sequence type=CDS   gene model=Glyma17g23845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCATCTCTATTTTAGGTATTCGGGGAATCCTCCTTAATAGACGAAATATTCCTATTATGTCAATGCCAATTGAATCAATGTTATTAGCTGTGAATTCGAACTTTTTGGTATTTTCCGTTTCTTCGGATGATATGATGGGTCAATCATTTGCTTCATTGGTTTCAACGGTGGCAGCTGCGGAATCCGCTATTGGGTTAGCCATTTTCATTATCACTTTCCGAGTCCGAGGGACTATTGCTGTAGAATTTATTAATAGCATTCAAGGTTAA

Predicted protein sequences of Glyma17g23845

Limit To All Plant Sequences

>Glyma17g23845.1   sequence type=predicted peptide   gene model=Glyma17g23845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIISILGIRGILLNRRNIPIMSMPIESMLLAVNSNFLVFSVSSDDMMGQSFASLVSTVAAAESAIGLAIFIITFRVRGTIAVEFINSIQG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain