Glyma17g23590 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma17g23590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma17g23590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma17g23590

Feature Type:	gene_model
Chromosome:	Gm17
Start:	23568287
stop:	23575007
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g23590

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G04220	AT	Annotation by Michelle Graham. TAIR10: 3-ketoacyl-CoA synthase 2 \| chr1:1119853-1122483 REVERSE LENGTH=528	SoyBase	E_val: 0	ISS
GO:0000038	GO-bp	Annotation by Michelle Graham. GO Biological Process: very long-chain fatty acid metabolic process	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0008610	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid biosynthetic process	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009411	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to UV	SoyBase	N/A	ISS
GO:0009611	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to wounding	SoyBase	N/A	ISS
GO:0009813	GO-bp	Annotation by Michelle Graham. GO Biological Process: flavonoid biosynthetic process	SoyBase	N/A	ISS
GO:0010345	GO-bp	Annotation by Michelle Graham. GO Biological Process: suberin biosynthetic process	SoyBase	N/A	ISS
GO:0042335	GO-bp	Annotation by Michelle Graham. GO Biological Process: cuticle development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0009922	GO-mf	Annotation by Michelle Graham. GO Molecular Function: fatty acid elongase activity	SoyBase	N/A	ISS
GO:0016747	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring acyl groups other than amino-acyl groups	SoyBase	N/A	ISS
PF08392	PFAM	FAE1/Type III polyketide synthase-like protein	JGI		ISS
PF08541	PFAM	3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal	JGI		ISS
UniRef100_I1MW41	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: 3-ketoacyl-CoA synthase n=1 Tax=Glycine max RepID=I1MW41_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_I1MW41	UniRef	Annotation by Michelle Graham. Best UniRef hit: 3-ketoacyl-CoA synthase n=1 Tax=Glycine max RepID=I1MW41_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma17g23590

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g23590 not represented in the dataset	Glyma17g23590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g23590 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g183700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g23590

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g23590

Limit To All Plant Sequences

>Glyma17g23590.1   sequence type=CDS   gene model=Glyma17g23590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTGAAGCATTTCAACATGAACATTTTCTTCACGTTGCTTATAGTTGTCACCTTAGCTAGTTTCTATGTTCCCCATTTGAAGCCTAGTCTTTCAATTACAATACCCTTCTGCATGGTTGCAACCCTAGCATACCAATTTATAATGAGAACACCCAACAAAATTTACTTGGTGGATTTTGCATGCTTCAAGCCAAGCCTTGAATGCCTGTGCTCCAAGGAAATGTTGCTCGACCGGGCGAAACGCGTCGGTTTCCTCTCCGACGAGAACTACAAGCTTGTGAACAAGATTCTTGACCGGTCCGGGTTGGGACCGTGGACGTATGTCCCGGAGGGTCTCCTGGAGATCCCTCCCAGACTAACGTTGGAGGAGGCAAGGAAGGAGACGGACACGGTGCTCTTCGGGGCCGTCGACGAGCTCTTGGAGAAAACCGGTGTTGAAGCCAAAGACATTGGGATTCTTGTGGTGAATTGTTGCTTGTTCAATCCCACACCATCTCTCTCTGACTCCATTGTCAACCGGTACAAGCTTAGAGGGAACATTTTGGCCTATAATCTTAGTGGCATGGGGTGCAGTGCTGGGGTTCTTGCTGTTGACTTTGCCAAACAGCTCCTACAGGCACACCCGAACTCGTACGCTTTGGTTCTAAGCACAGAAAACGAAATATCAAGCATGTACTGGGGCAACAACCCTTCAATGCTGCTGGTCAATTGCCTCTTCCGCATGGGCGGCTCTGCAGCCCTCCTATCAAGCCACCTCTCCGACCGCCAGCGCTCGAAGTACGAGCTCTTCCACACGCTCCGGACCCACGTTGGTGCCGACGACAACAGCTACAAATGTGTCTTTCAGGAAGAGGACGATGAGAACAAGGTAGGCGTGTCTCTATCCAAAGAGCTCATGAACGTCGCAAGGGATGCCTTGAAAGTCCACATCACCTCCCTCGGCCCGGTGGTGCTCCCGATCTCTGAGAAACTCAAGTTTCTGGTTAACCTAATCGAGAGGAAGGTATTGAAGACGAAGATCGAGTCCTACATGCCGAACTTCAAGCTTGCGTTCAAGCATTTTTGTATCCACACGGGAGGTAGGGCTGTGTTGGATCGCATGCAGAAGAGCCTCGAGCTTGAGGATTGGCACATGGAGCCTTCTAGAATGACACTTTACAGGTTTGGCAACACGTCTTCTAGCTCGGTCTGGTATGAGTTGGCATATTGTGAGGCCAAGGGGAGGATTAAGAAGGGTGATAGGGTTTGGCAAATGGCGTTCGGGTCCGGGTTCAAGTGTAACACTGCTGTGTGGGTTGCTTTGAATACGATCGAACCAGGGTCCATCAAGAGTCCGTGGAGGGATGAGATACATAATTTTCCTGTCAAGGTTGATCCACTCCCTGTGAAGAGTAACAAATGA

Predicted protein sequences of Glyma17g23590

Limit To All Plant Sequences

>Glyma17g23590.1   sequence type=predicted peptide   gene model=Glyma17g23590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLKHFNMNIFFTLLIVVTLASFYVPHLKPSLSITIPFCMVATLAYQFIMRTPNKIYLVDFACFKPSLECLCSKEMLLDRAKRVGFLSDENYKLVNKILDRSGLGPWTYVPEGLLEIPPRLTLEEARKETDTVLFGAVDELLEKTGVEAKDIGILVVNCCLFNPTPSLSDSIVNRYKLRGNILAYNLSGMGCSAGVLAVDFAKQLLQAHPNSYALVLSTENEISSMYWGNNPSMLLVNCLFRMGGSAALLSSHLSDRQRSKYELFHTLRTHVGADDNSYKCVFQEEDDENKVGVSLSKELMNVARDALKVHITSLGPVVLPISEKLKFLVNLIERKVLKTKIESYMPNFKLAFKHFCIHTGGRAVLDRMQKSLELEDWHMEPSRMTLYRFGNTSSSSVWYELAYCEAKGRIKKGDRVWQMAFGSGFKCNTAVWVALNTIEPGSIKSPWRDEIHNFPVKVDPLPVKSNK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain