Glyma17g23070 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g23070

Feature Type:	gene_model
Chromosome:	Gm17
Start:	22833264
stop:	22834322
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma17g23070

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G47840	AT	Annotation by Michelle Graham. TAIR10: hexokinase 3 \| chr1:17616243-17618859 REVERSE LENGTH=493	SoyBase	E_val: 7.00E-38	ISS
GO:0005975	GO-bp	Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process	SoyBase	N/A	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0004340	GO-mf	Annotation by Michelle Graham. GO Molecular Function: glucokinase activity	SoyBase	N/A	ISS
GO:0004396	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hexokinase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008865	GO-mf	Annotation by Michelle Graham. GO Molecular Function: fructokinase activity	SoyBase	N/A	ISS
GO:0016773	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor	SoyBase	N/A	ISS
PTHR19443	Panther	HEXOKINASE	JGI		ISS
PF03727	PFAM	Hexokinase	JGI		ISS
UniRef100_G7I766	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Hexokinase I n=1 Tax=Medicago truncatula RepID=G7I766_MEDTR	SoyBase	E_val: 3.00E-52	ISS
UniRef100_I1MY29	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MY29_SOYBN	SoyBase	E_val: 4.00E-65	ISS

Expression Patterns of Glyma17g23070

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g23070 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.17g182400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma17g23070

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma17g23070

Limit To All Plant Sequences

>Glyma17g23070.1   sequence type=CDS   gene model=Glyma17g23070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACTAACTAGTAACATGAAACAATACCGATATTTGAACAACGACATCATACTCCTTGTGGACCAGATTTTTAAGATGATGCAGAGTTATGATCATATTATTGTCAAACAAGAGCAATGTGTTGAATCCAATTTAAGTGAAAGAAAAACAGTTTTAGAGGTTTGTGAGACAATTGTAAAGCGAGGTGGGAGCTTAGCTGGTGCAGGAATAGTGGGGATTGTACAAAAAATGGAAGAGGATCAGAGAGGTCTCGTCTTTGGGAATGGAAAGAGAAGTGTTGTTGCCATCGATGGGGGCTTATATGAAAATTATCCTCAATACAGGGCTTATTTGCAAGATTCAGTCATAGAGCTGCTAGGAACAGAAAAGTCATTCTGTAATGTGGTGATAGAGCATACTAAAGATGGATCTGGAATAGGAGCTGTTGTATTGGCTACTTCAAACTCCATGTACAACCAAGACTTATAG

Predicted protein sequences of Glyma17g23070

Limit To All Plant Sequences

>Glyma17g23070.1   sequence type=predicted peptide   gene model=Glyma17g23070   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQLTSNMKQYRYLNNDIILLVDQIFKMMQSYDHIIVKQEQCVESNLSERKTVLEVCETIVKRGGSLAGAGIVGIVQKMEEDQRGLVFGNGKRSVVAIDGGLYENYPQYRAYLQDSVIELLGTEKSFCNVVIEHTKDGSGIGAVVLATSNSMYNQDL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain