SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g23060

Feature Type:gene_model
Chromosome:Gm17
Start:22823168
stop:22825186
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g23060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G73060AT Annotation by Michelle Graham. TAIR10: Low PSII Accumulation 3 | chr1:27479027-27481258 FORWARD LENGTH=358 SoyBaseE_val: 3.00E-55ISS
GO:0009073GO-bp Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family biosynthetic process SoyBaseN/AISS
GO:0010207GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II assembly SoyBaseN/AISS
GO:0016226GO-bp Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009571GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proplastid stroma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF09353PFAM Domain of unknown function (DUF1995) JGI ISS
UniRef100_I1KVM9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KVM9_SOYBN SoyBaseE_val: 3.00E-65ISS
UniRef100_Q9SSM1UniRef Annotation by Michelle Graham. Most informative UniRef hit: F3N23.26 protein n=1 Tax=Arabidopsis thaliana RepID=Q9SSM1_ARATH SoyBaseE_val: 4.00E-34ISS

Expression Patterns of Glyma17g23060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g23060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g23060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g23060
>Glyma17g23060.1   sequence type=CDS   gene model=Glyma17g23060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CGTTGGCAATCTACTGAGCCTCCATCACTCTACATATTCATTAACTGTAGTACACGTGAACTTGTGTATATAGAGAAGTATGTATTTGCTACGTCAACACTAACACTATTATTTAATCTTGAACTAGATACACTATGTGCTGATTTAGGCCTTCCGGGCTTCCCAGCCAAAGATTTGCACTACCGCTTTCTTTCTCAATTCACTTCATCCAAATCAGAGAGTATTCAAAGTTGCAATAGCACCTTATATTGTCAATTACAATGGAGTTGTATTCCGCTAGTACCCAGGTGCAACTATATATTTATATGGGTGATGCTTAAACAAGCAGATGGTTCTTATGCTTGCATAGCAGAAAGTGCAAACCACTTCAGCCTTGGCGAGGTCAAAGAGGAATTGTTGAGGGTCTTGGGACTTCAAGAAGAAGAGGGAAGTTCTCTAGAATTTCTTCGAAGAGGCTACAAG
Predicted protein sequences of Glyma17g23060
>Glyma17g23060.1   sequence type=predicted peptide   gene model=Glyma17g23060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
RWQSTEPPSLYIFINCSTRELVYIEKYVFATSTLTLLFNLELDTLCADLGLPGFPAKDLHYRFLSQFTSSKSESIQSCNSTLYCQLQWSCIPLVPRCNYIFIWVMLKQADGSYACIAESANHFSLGEVKEELLRVLGLQEEEGSSLEFLRRGYK






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo