SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22976

Feature Type:gene_model
Chromosome:Gm17
Start:22820708
stop:22821585
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g22976
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G44240AT Annotation by Michelle Graham. TAIR10: aminophospholipid ATPase 2 | chr5:17817619-17823598 FORWARD LENGTH=1107 SoyBaseE_val: 9.00E-41ISS
GO:0006812GO-bp Annotation by Michelle Graham. GO Biological Process: cation transport SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0015914GO-bp Annotation by Michelle Graham. GO Biological Process: phospholipid transport SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005768GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endosome SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005802GO-cc Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0016021GO-cc Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0000287GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium ion binding SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004012GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipid-translocating ATPase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0015662GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
PTHR24092Panther FAMILY NOT NAMED JGI ISS
PTHR24092:SF11Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_B9RVV5UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phospholipid-transporting atpase, putative n=1 Tax=Ricinus communis RepID=B9RVV5_RICCO SoyBaseE_val: 2.00E-40ISS
UniRef100_I1LUH9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LUH9_SOYBN SoyBaseE_val: 9.00E-46ISS

Expression Patterns of Glyma17g22976
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22976 not represented in the dataset
Glyma17g22976 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22976 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma17g22976
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g22976
>Glyma17g22976.1   sequence type=CDS   gene model=Glyma17g22976   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAATACTGGAGAGCCTTTATTCTTACAATTCCCTCCGTCCAAAACTAATAGAACCAAAGGGACAGCTTCTATCAATTGATGGCAAAACAGAGGAGGAGGTTTGTAGGAGTTTAGAGAGAGTGCTCCGTACTATGCGGATAACTACCTCAGAACCCAAGGATGTGGCTTTTGTTGTTGATGGCTGGGCACTTGAGATTGCACTTACCCACTATCGTAAAGCTTTCACTGAGCTGGCAGTTTTGTCAAGGACTGCTATATGTTGTCGTGTGACACCATCACAAAAAGCACAGTTTCTTTTAATTAACTTATTGCAAGAAGAAGGGGGTGATAAGACCAACATCTTGTGTTTTTCTGTAACGGGAACATAA
Predicted protein sequences of Glyma17g22976
>Glyma17g22976.1   sequence type=predicted peptide   gene model=Glyma17g22976   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEILESLYSYNSLRPKLIEPKGQLLSIDGKTEEEVCRSLERVLRTMRITTSEPKDVAFVVDGWALEIALTHYRKAFTELAVLSRTAICCRVTPSQKAQFLLINLLQEEGGDKTNILCFSVTGT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo