SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma17g22724

Feature Type:gene_model
Chromosome:Gm17
Start:22432458
stop:22437770
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma17g22724
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G23580AT Annotation by Michelle Graham. TAIR10: calmodulin-like domain protein kinase 9 | chr5:7950388-7952433 REVERSE LENGTH=490 SoyBaseE_val: 3.00E-14ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0009738GO-bp Annotation by Michelle Graham. GO Biological Process: abscisic acid mediated signaling pathway SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004683GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin-dependent protein kinase activity SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_I1KBT7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBT7_SOYBN SoyBaseE_val: 1.00E-14ISS
UniRef100_Q5XLG3UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcium-dependent protein kinase 1 n=1 Tax=Vicia faba RepID=Q5XLG3_VICFA SoyBaseE_val: 4.00E-12ISS

Expression Patterns of Glyma17g22724
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma17g22724 not represented in the dataset
Glyma17g22724 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma17g22724 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.17g181900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma17g22724
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma17g22724
>Glyma17g22724.1   sequence type=CDS   gene model=Glyma17g22724   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGCCAATTCGGCACAACCTTCCTCTGCATGCACAACGCCACGGGACGCCCTTTCACCTGCAAGTCAATCCCGAAGCGGAAACTGCTCTGCAAGGAGGACTACGACGATGTATGCACCACCTCTCCGAGCACCCCAGCCCCAACACATAGGGACCTCAAGCCTGAGAACTTTCTCTTTGATACTGTTGAGGAGGGTGCTAAGGTCAAAACTACTGATTTTGGGCTCTCCGTGTTTTATAACCCAGGTTTGATGCCGAGGGAGAGGGCTTGGTCGTGGGTTTTGGTGGAGGTGGGGATTCTGATGATGTCTTTGAGTTTTCCTTGGCGGAGGAGCTCGCCGATGCAGTCGCTTGGCAGTGGAGCCAATGCCGAGGACCATGCCGGACTTGACATACTCGATGACCTTGTAGGTGGCAAGGAGGAGGGTGCAGACTGTTGA
Predicted protein sequences of Glyma17g22724
>Glyma17g22724.1   sequence type=predicted peptide   gene model=Glyma17g22724   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGQFGTTFLCMHNATGRPFTCKSIPKRKLLCKEDYDDVCTTSPSTPAPTHRDLKPENFLFDTVEEGAKVKTTDFGLSVFYNPGLMPRERAWSWVLVEVGILMMSLSFPWRRSSPMQSLGSGANAEDHAGLDILDDLVGGKEEGADC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo